KEGG   Geobacillus sp. C56-T3: GC56T3_1716Help
Entry
GC56T3_1716       CDS       T01245                                 

Definition
BAAT/acyl-CoA thioester hydrolase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
gct  Geobacillus sp. C56-T3
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1823859..1824611
Genome map
AA seq 250 aa AA seqDB search
MSEQYPVLPGAEPFYAENGPVGVLLVHGFTGTPHSMRPLAEAYAKAGYTVCLPRLKGHGT
HYEDMERTTFHDWIASVEEGFEWLKKRCQTIFVTGLSMGGTLTLYMAERYPSIRGIVLIN
AAIDIPAIRAGLAGGGELPRYLDSIGSDLKNPDVKELAYEKTPTASLLQLARLMEQVKGE
LERVTCPILIFVSNEDHVVPPENADLIFQRIPSAQKEMVRLQNSYHVATLDYDQPVIIER
SLEFFAKHAD
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaacaatatccggtgcttccgggcgccgagccgttttacgccgaaaacgggccg
gtcggggtgctgctcgtgcacggattcacgggcacgccccacagcatgcgcccgctcgct
gaggcgtatgcgaaagcggggtataccgtttgtctgccgcgtttaaaaggccatgggaca
cattatgaagatatggagcggacgacattccacgactggattgcctcggtcgaagaagga
tttgaatggctgaaaaaacgatgccaaaccatttttgtcaccggtctgtccatgggtggg
acgctgacgctttatatggcggaacgttacccgtccatccgcggcatcgtcctgatcaat
gcggcgattgacatcccggccatccgcgctggtctagcgggtggcggcgagctgccgagg
tatctggattcgatcggttcggacttgaaaaatccggatgtgaaagagctggcatacgag
aaaacgccgaccgcttcgcttcttcagctggctaggctgatggagcaagtgaaaggcgag
ctggaacgtgtgacatgcccgattttaattttcgtctcgaacgaagaccatgtcgtgccg
ccagaaaacgccgatctcatttttcaacgcattccatcggcgcaaaaagaaatggtccgt
cttcaaaacagctatcatgtggcgacgcttgactatgatcaaccggtcattatcgaacga
tcgctcgaattttttgctaagcatgcggattga

DBGET integrated database retrieval system