KEGG   Geobacillus sp. C56-T3: GC56T3_1754Help
Entry
GC56T3_1754       CDS       T01245                                 

Definition
peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
gct  Geobacillus sp. C56-T3
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:gct00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    GC56T3_1754
  Metabolism of other amino acids
   00480 Glutathione metabolism
    GC56T3_1754
Enzymes [BR:gct01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     GC56T3_1754
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1860970..1861446
Genome map
AA seq 158 aa AA seqDB search
MSVYEFSAKTIRGEEQPLSVYRGNVLLIVNTASRCGFTPQYKELQELYDEYRDRGFVVLG
FPCNQFGGQEPGTEEEIEQFCQLNYGVTFPLFAKVDVNGDNAHPLFQYLKEEAPGALGTK
AIKWNFTKFLVDRNGKVVARFAPQTKPSELRKEIEKLL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtatatgaattcagcgccaaaaccattcgcggagaggaacaaccgctttccgtc
tatcgaggcaacgtgctgttgattgtcaacacggcgagccgttgcggcttcaccccgcag
tataaagaactgcaggagctgtatgacgaatatcgcgatcgcgggtttgttgtgctcggc
tttccgtgcaaccagttcggcggccaagagccggggacggaagaagaaattgagcaattt
tgccagttgaattacggtgtgacgttcccgctgtttgcgaaagtggatgtgaatggcgat
aacgcccatccgctgtttcaatatttgaaagaagaggcgccgggggcattgggaacaaag
gcgatcaaatggaatttcacgaagtttttggtcgaccgcaacggcaaggttgtcgctcgt
ttcgcaccgcaaacaaagccaagcgagctgagaaaggaaattgaaaagctgctgtaa

DBGET integrated database retrieval system