KEGG   Geobacillus sp. C56-T3: GC56T3_1764Help
Entry
GC56T3_1764       CDS       T01245                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
gct  Geobacillus sp. C56-T3
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:gct00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:gct00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1868877..1869371
Genome map
AA seq 164 aa AA seqDB search
MISHIVAMDENRVIGKDNRLPWHLPADLAYFKRVTMGYAIVMGRKTFEAIGRPLPGRDNV
VVTGNRSFRPEGCLVLHSLEEVKQWIASRADEVFIIGGAELFRATMPIVDRLYVTKIFAS
FPGDTFYPPISDDEWEIVSYTPGGKDEKNPYEHAFIIYERKKAK
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgatttcgcacattgtggcaatggatgaaaaccgggtgatcggcaaagacaaccgcttg
ccttggcatttgccggccgatttggcgtattttaaacgggtgacaatgggctatgccatc
gtgatggggcgcaaaacgtttgaagcgatcggccggccgcttcccggccgcgataacgtc
gttgtcacgggcaaccgctcgtttcgcccggaaggctgccttgtgcttcattcgctcgag
gaagtcaagcaatggatcgcatcgcgcgctgatgaagtgtttatcatcggcggggccgaa
ctgtttcgggcgacgatgccgattgtcgaccggctgtatgtgacaaaaatttttgcttcc
ttccccggcgatacgttttatccgcccatttctgacgatgaatgggaaatcgtttcctat
acgccaggagggaaagatgaaaagaatccgtatgaacacgcctttatcatttatgagcgg
aaaaaggcgaaatag

DBGET integrated database retrieval system