KEGG   Geobacillus sp. C56-T3: GC56T3_1778Help
Entry
GC56T3_1778       CDS       T01245                                 

Definition
pyridoxal-5'-phosphate-dependent protein subunit beta
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
gct  Geobacillus sp. C56-T3
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:gct01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:gct00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:gct00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1880791..1882008
Genome map
AA seq 405 aa AA seqDB search
MSFSYVSHLYCPKCERTYDVDQIHQLCECGSPLLVAYDLESMRQKVKRDVLREREANLWR
YHELLPVKHPEHIVSLGEGMTPLVPMMRLGRKIGIEALYMKDEGVIPTRTFKARGAAVGV
SKAKELGVKQLAMPTNGNAGAAWSLYAARAGIQATVVMPVDAPELTRKECAIAGAELYLV
NGLISDAGQIVAKAIREYGWYDASTLKEPYRIEGKKTMGLEIAEQFSWQLPDVILYPTGG
GVGLIGIYKAIKELQALGWVDGRMPRLVAVQAEHCAPIVKAWKEKKRESEFWPNAHTVAF
GINVPKALGDFLVLEAVYETDGCAIAVNDEAILAEQRTAAELEGAFICPEGAAAFAAART
LRESGWIRDGETVVVLNTGTGLKYADTVDVHPPVLEPGDMLPKEN
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtcattcagctacgtgtctcatctgtattgtccgaagtgtgaacgtacatacgatgtc
gaccaaatccatcaactttgcgaatgcggttcgccgcttcttgtcgcttacgacttggag
tcgatgcgccaaaaagtcaagagggatgtgctgagggaacgtgaagcgaatttatggcgt
tatcatgagttgctgccggtaaagcatcctgaacatatcgtgtcgctcggcgaagggatg
acgccgcttgtgccgatgatgcggcttggcagaaagatcggcattgaagcgctctacatg
aaagacgaaggggtcattccaacaagaacgttcaaagcccgcggggcggcggtcggggtt
tccaaagccaaggaactgggcgtcaagcagcttgcgatgccgacaaacggcaacgccggc
gcggcatggtcgctctacgcggcgcgggcgggcattcaggcgacagtcgtcatgccggtt
gatgcaccggaactgacgcgaaaggaatgcgccatcgctggggcggaactgtatttagtc
aacggcctcattagcgatgccgggcaaatcgtcgccaaagcgatccgcgaatacggatgg
tacgatgcgtcgacgttgaaagaaccgtaccggattgaagggaagaaaacgatgggactg
gagatcgccgaacagttctcgtggcagctcccggatgtcattttgtatccgaccggcggc
ggcgtcgggttgatcggcatttacaaggcgatcaaagaactgcaggcgctcggctgggtg
gacggccgcatgccgcggcttgtcgctgtgcaggccgagcattgcgcgccgatcgtcaag
gcgtggaaggagaaaaaacgtgaatcggagttttggccgaacgcccatacagtggcgttt
ggcatcaatgtgccgaaagcgcttggcgactttcttgttcttgaggcggtgtatgagacg
gacggttgcgctattgccgtcaacgatgaagcaattttggctgaacagcggacggcagcc
gaactcgaaggggcgttcatttgcccggaaggagcggcggcgtttgcggcggcacgaacg
ttgcgcgagagcggttggattcgtgatggggagacggtcgtcgtattaaataccggaacc
gggctgaaatacgccgatacggtggacgtccatccgccggtgctcgagccgggggatatg
cttccaaaggagaattga

DBGET integrated database retrieval system