KEGG   Geobacillus sp. C56-T3: GC56T3_2056Help
Entry
GC56T3_2056       CDS       T01245                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
gct  Geobacillus sp. C56-T3
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:gct00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    GC56T3_2056
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    GC56T3_2056
   00650 Butanoate metabolism
    GC56T3_2056
  Amino acid metabolism
   00360 Phenylalanine metabolism
    GC56T3_2056
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GC56T3_2056
   00622 Xylene degradation
    GC56T3_2056
   00621 Dioxin degradation
    GC56T3_2056
Enzymes [BR:gct01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     GC56T3_2056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2158523..2159422)
Genome map
AA seq 299 aa AA seqDB search
MEKINVAILGSGNIGTDLMLKLERSDVLQLTTVIGIDPQSEGLRLAKEKGYHVIDSGIQA
FLEHPEWADFVFDATSAKAHIRHAKLLKQAGKVVFDLTPAAVGPFVVPPVNITEHLEETN
INFITCGGQATIPIVHAIGRVQPVAYAEIVATISSKSAGPGTRANIDEFTETTARGLEKI
GGAKRGKAIIILNPAEPPILMRNTIYALVEGEKAAAREICDSIEEMVETIRSYVPGYRLR
TSPIIEGNQVTVMVEVEGAGDYLPKYAGNLDIMTAAAVKVAEEVAKHRLSKLLAEEGKR
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtggagaagatcaatgtagcaattcttggttctgggaacatcgggactgacttgatgttg
aagcttgaacgttcggatgtgttgcagttgacaacagtaattgggatcgatcctcaatcg
gaagggctgcgtctagcaaaagagaaagggtatcacgtcattgacagcggcatccaagcg
tttttggagcatcccgaatgggctgatttcgtcttcgacgcgacgtcggcgaaagcgcac
atccgtcatgccaaactgttgaagcaggctgggaaggtcgtctttgatttgactcctgcg
gccgttggaccgtttgttgtgccgcctgtcaatataacggaacatttggaagagaccaac
attaacttcatcacatgcggtggacaggcgacgattccgattgtccacgccattgggcgc
gtgcagccggttgcttacgctgaaattgttgcgacgatttcaagcaaaagcgcagggccg
ggaacaagagcgaacattgatgaatttacggaaacgactgctcgagggctcgaaaaaatc
ggtggggcgaagcgcggaaaagccatcattattctcaatccggctgaaccgcccattttg
atgagaaacacaatatacgcacttgtcgaaggggagaaagcagcggcgcgggaaatttgc
gactcgatcgaggaaatggtagaaacgatccgctcgtacgttcccggctatcggctccgc
acgagtccgatcattgaaggaaatcaggtgacggtcatggttgaagtggaaggagcgggt
gattatttgccgaagtacgctggaaacttggatattatgaccgccgctgcggtgaaagtg
gcggaggaagtggcgaagcatcgattgtcgaagttgttggctgaggaggggaaacgatga

DBGET integrated database retrieval system