KEGG   Geobacillus sp. C56-T3: GC56T3_2458Help
Entry
GC56T3_2458       CDS       T01245                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
gct  Geobacillus sp. C56-T3
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:gct00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:gct00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2605635..2607104)
Genome map
AA seq 489 aa AA seqDB search
MKLLTLLSHLPGFWVHHGGNPDIVALEMDSRRVAPGSLFFCLKGFTVDGHDFAEEAVARK
AAAIVAERPLSVDVPVVLVSDSRRAMAILADAFYGRPTHRLHLIGVTGTNGKTTTTSIME
QIARKAGKKTGLIGTVHIKVGDRSYPAANTTPESLILQRTFKQMVDEGVEFVAMEVSSHA
LHQGRVHGCDYDVAVFTNLTQDHLDYHGTMEEYRNAKGLLFAQLGNRYDERRPKFAVLNH
DDPVSQYYKHMTAAPIVTYGMREKSDVMAEQIRITAGGMAFRLCTPHGSAAVETKLVGSF
NVYNILAAAAACLASGFSLETIAAALADVEPVPGRFETVDEGQNFTIIVDYAHTPDSLEN
ALKTVRQLAKRNVYVVIGCGGDRDRSKRPLMAQVAVRYADVAIFTSDNPRSEDPKQILRD
MEAGVSAEIGKHVTIPDREEAIRYAIGQAQEGDVVLIAGKGHETYQIIGNDVIEFDDRAV
ARAAVKERG
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgctgacgttgctgtcacacttgcccggtttttgggtgcaccatggaggcaat
cccgatatcgtggcgctcgaaatggactcgcgccgcgttgcccccggttctctctttttt
tgccttaaagggtttacagtagacggacacgactttgccgaggaagcggtggcgcgcaaa
gcggcggcgatcgtggccgagcgaccgctttccgttgatgttccggtcgttcttgtgtcg
gacagccggcgggcgatggcgattttagcggacgcgttttacgggcggccgacccaccgc
cttcatttaatcggagtgacaggcacaaacggcaagacgacgacaacgtcgatcatggaa
caaatcgcgagaaaagccggcaagaaaacagggctcattggcacggttcacatcaaggtc
ggcgaccgctcctatccggcggccaatacgacgccggagtcgctcattttgcagcgcacg
tttaaacagatggtcgatgaaggagtggagtttgtcgccatggaagtgtcgtcgcacgcg
ctgcaccaagggcgggtgcatggctgcgattacgatgtggccgtctttacgaacttaacg
caagaccatttggattatcacgggacaatggaagaatatcggaacgccaaagggcttttg
tttgcccagctcggcaaccgctacgacgaacggcggccgaaatttgccgttctcaatcat
gacgatccggtttcgcagtattataaacatatgacggccgcgccgatcgtcacatacggg
atgagggaaaaaagcgatgtgatggcggaacagatccgcataaccgcaggcggcatggcg
tttcggctttgcacgccgcacggatcggcggcggtcgaaacgaaacttgtcggctcgttc
aatgtctataacattctcgccgctgccgctgcctgccttgcctctggcttttcgcttgaa
acgatcgccgcggcgcttgcggatgtcgagccggtgccggggcggtttgaaacggttgat
gaagggcaaaactttacgatcatcgtcgattacgcccacacgccggacagtttagaaaat
gccttaaaaacggtgcgccaattggcgaagcgaaacgtgtatgtcgtcatcggctgcggc
ggcgaccgcgaccggtcgaaacggccgctcatggcgcaggtggcggtgcggtatgcggat
gtcgctatttttacctccgacaatccgcgttcggaagacccgaagcaaattttgcgcgac
atggaagcgggagtaagcgctgagatcggaaagcatgtgacgattcctgaccgtgaagag
gcgatccgctacgccattggccaggcgcaggaaggcgatgttgtgttgattgccggcaaa
gggcatgaaacgtatcaaatcattggcaacgatgtgattgagtttgacgatcgcgctgtt
gcccgagcggcagtgaaggagagaggatga

DBGET integrated database retrieval system