KEGG   Geobacillus sp. C56-T3: GC56T3_2513Help
Entry
GC56T3_2513       CDS       T01245                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gct  Geobacillus sp. C56-T3
Pathway
gct00010  Glycolysis / Gluconeogenesis
gct00020  Citrate cycle (TCA cycle)
gct00620  Pyruvate metabolism
gct01100  Metabolic pathways
gct01110  Biosynthesis of secondary metabolites
gct01120  Microbial metabolism in diverse environments
gct01130  Biosynthesis of antibiotics
gct01200  Carbon metabolism
Module
gct_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gct00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GC56T3_2513
   00020 Citrate cycle (TCA cycle)
    GC56T3_2513
   00620 Pyruvate metabolism
    GC56T3_2513
Enzymes [BR:gct01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     GC56T3_2513
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N ATP-synt_ab_Xtn
Motif
Other DBs
NCBI-ProteinID: ADI27471
JGI: GC56T3_2513
Position
complement(2656364..2657668)
Genome map
AA seq 434 aa AA seqDB search
MAFEFKLPDIGEGIHEGEIVKWFVKPGDEVNEDDVLCEVQNDKAVVEIPSPVKGKVLEIL
VPEGTVATVGQTLITLDAPGYENMTFKGQEHEEVKKEEKAETVSKKEMVETAAPSAPAAE
AEADPNRRVIAMPSVRKYAREKGVDIRLVQGTGKNGRILKEDIDAFLAGGAKAAAEPTPQ
AAEEKAAPQAPAAKPVVPEGEFPETREKMSGIRRAIAKAMVHSKHTAPHVTLMDEADVTK
LVAHRKKFKAIAAEKGIKLTFLPYVVKALVSALREYPVLNTSIDDATEEIIHKHYYNIGI
AADTDRGLLVPVIKHADRKPIFALAKEINELAEKAREGKLMPNEMKGASCTITNIGSAGG
QWFTPVINHPEVAILGIGRIAEKPIVRDGEIVAAPVLALSLSFDHRMIDGATAQKALNHI
KQLLSDPELLLMEA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttaagctgccggacattggcgaaggcattcacgaaggcgagatcgtc
aaatggttcgtcaagccgggcgatgaagtgaacgaagacgacgtgttgtgcgaagtgcaa
aacgacaaagcggtcgtcgagatcccatctcctgtcaaggggaaagtgcttgagattctc
gtcccggaaggaacggtggcgacggttgggcaaacgctcattacgctcgatgcgccgggc
tatgaaaacatgacgtttaaaggacaagaacacgaagaagtgaaaaaagaggaaaaagcg
gaaacggtgtcgaaaaaggaaatggttgagaccgctgctccgagcgcaccggcggccgaa
gcggaagccgacccgaaccgccgcgtcatcgcgatgccgtctgtgcgcaaatatgcgcgt
gaaaaaggcgtcgatatccgcctcgtccaaggcacggggaaaaacggccgcattttgaaa
gaagatattgatgccttcctcgccggcggcgcgaaagccgcggctgagccgacgccgcaa
gcggcggaagagaaggcagcgccgcaagcgccagcggcgaaaccggttgtgccggaaggc
gaattcccggaaacgcgcgagaaaatgagcggcatccgtcgggcgatcgccaaggccatg
gtgcattcgaaacatacggccccgcacgtgacgctgatggacgaagccgatgtgacgaag
cttgttgctcaccgaaaaaaattcaaggccattgcggcggaaaaaggcatcaagctgacg
ttcttgccgtatgtcgtcaaagcgcttgtttccgcgctgcgtgaatatccggtgctgaat
acgtcgatcgacgatgcgacggaggaaattattcataagcattactacaacatcggcatc
gccgctgatacggatcgagggttgctcgtgccggtcattaaacatgccgaccggaagccg
attttcgcgctggcgaaggaaatcaacgaactcgctgaaaaagcgcgcgaaggcaaactg
atgccaaacgaaatgaaaggcgcatcgtgcacgatcacgaacatcggctcagccggcggg
caatggtttacgccggtcatcaaccatccagaagtggcgattcttggcatcggccgcatt
gccgaaaaaccgatcgtccgcgacggtgaaattgtcgctgctccggtcttggcgctctcg
ctcagctttgaccatcggatgatcgacggagcgacagcgcaaaaagcgctcaaccatatc
aagcagctgttaagcgatccagaattattattaatggaggcgtaa

DBGET integrated database retrieval system