KEGG   Geobacillus sp. C56-T3: GC56T3_2548Help
Entry
GC56T3_2548       CDS       T01245                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gct  Geobacillus sp. C56-T3
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gct00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GC56T3_2548
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GC56T3_2548
  Amino acid metabolism
   00310 Lysine degradation
    GC56T3_2548
Enzymes [BR:gct01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     GC56T3_2548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2689963..2691225)
Genome map
AA seq 420 aa AA seqDB search
MAEIKVPELAESITEGTIAQWLKKPGDYVEKGESICELETDKVNVEIMAEESGVLQQLLA
NEGDTVAVGQAIAIIGEGAAAPTAALQAAPQTADETETVAPADSNEQPAPQPVAVAQAPS
QRPIASPAARKMAREKGIDLTQVPTADPLGRVRKQDVASFAAQPAAAPQPAPQASPTPAA
VPAAEAGKPVIREKMSRRRQTIAKRLLEVTQTTAMLTTFNEIDMSAVIDLRKRKKDKFFE
EHDVRLGFMSFFVKAAVAALKKYPYVNAEIQGDEILLKKYYDIGVAVSTDEGLVVPVVRD
CDRKNFAEIERDIAELATKARSNKLSLADLQGGTFTITNGGVFGSLLSTPLLNGPQVGIL
GMHSIKLRPVAVDEERIENRPMMYVALSYDHRIIDGKEAVGFLKTVKDLIENPEDLLLES
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtggctgagatcaaagtcccagagttagcagaatccatcacggagggaacgatcgcccaa
tggctgaaaaaaccgggcgactacgtggaaaaaggagaatcgatttgcgagcttgaaacg
gataaagtgaacgtggaaattatggcggaagagtcgggtgttttgcaacagctgcttgcc
aatgaaggcgatacggttgcggttggccaagcgatcgccattatcggcgaaggagcggca
gcaccgactgccgctttgcaagctgctccgcagacagccgatgaaacggaaacggtcgcg
ccggccgacagcaatgaacagccagcgccgcagccagtcgcggttgcccaggcgccgagc
cagcggccaatcgcctctccggccgcccggaaaatggcgcgtgaaaaaggaatcgacttg
acgcaagtgccaacggctgatccgcttgggcgcgtgcgcaaacaagacgtcgcttcgttt
gccgcacaaccggccgccgccccgcagccggctccgcaagcctcgccgacgccggctgcc
gttccagccgctgaggccggcaagccggtcatccgcgaaaaaatgtcgcgccgtcggcaa
acgatcgccaaacggctgcttgaagtgacgcaaacgaccgcgatgttgacgacgttcaac
gaaattgacatgtcggcggtcatcgatctgcgcaagcggaaaaaagataaatttttcgaa
gagcatgacgtccgccttggctttatgtcatttttcgtcaaagcggctgtcgcggcgctg
aaaaaatatccgtacgtcaacgcggaaattcaaggcgatgaaattttgttgaaaaaatat
tatgatatcggcgtcgccgtgtcgacggacgaagggcttgtcgttccggttgtgcgcgac
tgcgaccggaaaaacttcgctgaaattgagcgcgacattgccgaattggcgacgaaagcg
cgcagcaataagttgtcgcttgccgatttgcaaggcggtacgtttacgatcaccaacggc
ggcgtgttcggttcactgttgtcgaccccgcttctcaacgggccgcaagtcggcatttta
gggatgcattcgatcaaattgcgtccggtcgccgtcgatgaagagcggatcgaaaaccgt
cccatgatgtacgtcgccttgtcatacgaccaccgcatcatcgatggcaaagaggccgta
ggattcttaaaaacggtgaaagacttgatcgaaaatccggaagatttgctgcttgaaagc
tga

DBGET integrated database retrieval system