KEGG   Geobacillus sp. C56-T3: GC56T3_2548Help
Entry
GC56T3_2548       CDS       T01245                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gct  Geobacillus sp. C56-T3
Pathway
gct00020  Citrate cycle (TCA cycle)
gct00310  Lysine degradation
gct01100  Metabolic pathways
gct01110  Biosynthesis of secondary metabolites
gct01120  Microbial metabolism in diverse environments
gct01130  Biosynthesis of antibiotics
gct01200  Carbon metabolism
Module
gct_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gct_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gct00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GC56T3_2548
  Amino acid metabolism
   00310 Lysine degradation
    GC56T3_2548
Enzymes [BR:gct01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     GC56T3_2548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N
Motif
Other DBs
NCBI-ProteinID: ADI27506
JGI: GC56T3_2548
Position
complement(2689963..2691225)
Genome map
AA seq 420 aa AA seqDB search
MAEIKVPELAESITEGTIAQWLKKPGDYVEKGESICELETDKVNVEIMAEESGVLQQLLA
NEGDTVAVGQAIAIIGEGAAAPTAALQAAPQTADETETVAPADSNEQPAPQPVAVAQAPS
QRPIASPAARKMAREKGIDLTQVPTADPLGRVRKQDVASFAAQPAAAPQPAPQASPTPAA
VPAAEAGKPVIREKMSRRRQTIAKRLLEVTQTTAMLTTFNEIDMSAVIDLRKRKKDKFFE
EHDVRLGFMSFFVKAAVAALKKYPYVNAEIQGDEILLKKYYDIGVAVSTDEGLVVPVVRD
CDRKNFAEIERDIAELATKARSNKLSLADLQGGTFTITNGGVFGSLLSTPLLNGPQVGIL
GMHSIKLRPVAVDEERIENRPMMYVALSYDHRIIDGKEAVGFLKTVKDLIENPEDLLLES
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtggctgagatcaaagtcccagagttagcagaatccatcacggagggaacgatcgcccaa
tggctgaaaaaaccgggcgactacgtggaaaaaggagaatcgatttgcgagcttgaaacg
gataaagtgaacgtggaaattatggcggaagagtcgggtgttttgcaacagctgcttgcc
aatgaaggcgatacggttgcggttggccaagcgatcgccattatcggcgaaggagcggca
gcaccgactgccgctttgcaagctgctccgcagacagccgatgaaacggaaacggtcgcg
ccggccgacagcaatgaacagccagcgccgcagccagtcgcggttgcccaggcgccgagc
cagcggccaatcgcctctccggccgcccggaaaatggcgcgtgaaaaaggaatcgacttg
acgcaagtgccaacggctgatccgcttgggcgcgtgcgcaaacaagacgtcgcttcgttt
gccgcacaaccggccgccgccccgcagccggctccgcaagcctcgccgacgccggctgcc
gttccagccgctgaggccggcaagccggtcatccgcgaaaaaatgtcgcgccgtcggcaa
acgatcgccaaacggctgcttgaagtgacgcaaacgaccgcgatgttgacgacgttcaac
gaaattgacatgtcggcggtcatcgatctgcgcaagcggaaaaaagataaatttttcgaa
gagcatgacgtccgccttggctttatgtcatttttcgtcaaagcggctgtcgcggcgctg
aaaaaatatccgtacgtcaacgcggaaattcaaggcgatgaaattttgttgaaaaaatat
tatgatatcggcgtcgccgtgtcgacggacgaagggcttgtcgttccggttgtgcgcgac
tgcgaccggaaaaacttcgctgaaattgagcgcgacattgccgaattggcgacgaaagcg
cgcagcaataagttgtcgcttgccgatttgcaaggcggtacgtttacgatcaccaacggc
ggcgtgttcggttcactgttgtcgaccccgcttctcaacgggccgcaagtcggcatttta
gggatgcattcgatcaaattgcgtccggtcgccgtcgatgaagagcggatcgaaaaccgt
cccatgatgtacgtcgccttgtcatacgaccaccgcatcatcgatggcaaagaggccgta
ggattcttaaaaacggtgaaagacttgatcgaaaatccggaagatttgctgcttgaaagc
tga

DBGET integrated database retrieval system