KEGG   Geobacillus sp. C56-T3: GC56T3_3075Help
Entry
GC56T3_3075       CDS       T01245                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gct  Geobacillus sp. C56-T3
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:gct00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GC56T3_3075
   01230 Biosynthesis of amino acids
    GC56T3_3075
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GC56T3_3075
   00051 Fructose and mannose metabolism
    GC56T3_3075
   00562 Inositol phosphate metabolism
    GC56T3_3075
Enzymes [BR:gct01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     GC56T3_3075
Exosome [BR:gct04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   GC56T3_3075
  Exosomal proteins of bladder cancer cells
   GC56T3_3075
  Exosomal proteins of melanoma cells
   GC56T3_3075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
complement(3224135..3224896)
Genome map
AA seq 253 aa AA seqDB search
MRKRIIAGNWKMHKTLAEAVQFVEDVKGHVPPADEVDSVVCAPFLFLDRLVQAADGTDLK
IGAQTMHFADQGAYTGEVSPVMLKDLGVTYVILGHSERRQMFAETDETVNKKVLAAFTRG
LTPIICCGESLEEREAGQTNAVVASQVEKALAGLTPDQVKQAVIAYEPIWAIGTGKSSTA
EDANEVCGHIRSVVSRLFGPEAAEAIRIQYGGSVKPDNIRDFLAQEHIDGALVGGASLEP
ASFLQLVEAGRHE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaacgcatcattgcaggcaactggaaaatgcataaaacattggcggaagctgtt
caatttgtcgaggacgtaaaagggcacgtgccgccggccgacgaagtggattccgtcgtt
tgcgcgccgtttctctttttggatcggttggtgcaagcggcagacggcacggatttaaaa
atcggggcgcaaacgatgcactttgccgaccaaggggcgtacacaggcgaagtgagcccg
gtcatgctcaaagatctcggcgtcacgtacgtcatcctcggccattcggagcgccggcaa
atgttcgccgaaacagatgagaccgtgaacaaaaaagtgttggccgccttcacccgcggc
ttgacgccgattatttgctgcggcgaatcgcttgaggagcgggaagcggggcagacaaac
gccgttgtcgcctcgcaagtggaaaaagcgctcgccggcttgacgccggatcaagtgaag
caagcggtcatcgcttacgagccgatttgggcgatcggcacgggcaaatcgtcgacggcg
gaagatgcgaacgaagtgtgcggccatatccgttcggtcgtttcgcgcctgtttggcccg
gaggcggcggaagcgatccgcatccaatacggcggcagcgtcaaaccggacaacatccgc
gacttcttggcgcaagaacatatagacggcgccttagtcggcggggcgagcctcgagccg
gcttcattcttgcaattggtggaggcggggcgccatgagtaa

DBGET integrated database retrieval system