KEGG   Geobacillus sp. C56-T3: GC56T3_3075Help
Entry
GC56T3_3075       CDS       T01245                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gct  Geobacillus sp. C56-T3
Pathway
gct00010  Glycolysis / Gluconeogenesis
gct00051  Fructose and mannose metabolism
gct00562  Inositol phosphate metabolism
gct01100  Metabolic pathways
gct01110  Biosynthesis of secondary metabolites
gct01120  Microbial metabolism in diverse environments
gct01130  Biosynthesis of antibiotics
gct01200  Carbon metabolism
gct01230  Biosynthesis of amino acids
Module
gct_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
gct_M00002  Glycolysis, core module involving three-carbon compounds
gct_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:gct00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GC56T3_3075
   00051 Fructose and mannose metabolism
    GC56T3_3075
   00562 Inositol phosphate metabolism
    GC56T3_3075
Enzymes [BR:gct01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     GC56T3_3075
Exosome [BR:gct04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   GC56T3_3075
  Exosomal proteins of bladder cancer cells
   GC56T3_3075
  Exosomal proteins of melanoma cells
   GC56T3_3075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADI28007
JGI: GC56T3_3075
Position
complement(3224135..3224896)
Genome map
AA seq 253 aa AA seqDB search
MRKRIIAGNWKMHKTLAEAVQFVEDVKGHVPPADEVDSVVCAPFLFLDRLVQAADGTDLK
IGAQTMHFADQGAYTGEVSPVMLKDLGVTYVILGHSERRQMFAETDETVNKKVLAAFTRG
LTPIICCGESLEEREAGQTNAVVASQVEKALAGLTPDQVKQAVIAYEPIWAIGTGKSSTA
EDANEVCGHIRSVVSRLFGPEAAEAIRIQYGGSVKPDNIRDFLAQEHIDGALVGGASLEP
ASFLQLVEAGRHE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaacgcatcattgcaggcaactggaaaatgcataaaacattggcggaagctgtt
caatttgtcgaggacgtaaaagggcacgtgccgccggccgacgaagtggattccgtcgtt
tgcgcgccgtttctctttttggatcggttggtgcaagcggcagacggcacggatttaaaa
atcggggcgcaaacgatgcactttgccgaccaaggggcgtacacaggcgaagtgagcccg
gtcatgctcaaagatctcggcgtcacgtacgtcatcctcggccattcggagcgccggcaa
atgttcgccgaaacagatgagaccgtgaacaaaaaagtgttggccgccttcacccgcggc
ttgacgccgattatttgctgcggcgaatcgcttgaggagcgggaagcggggcagacaaac
gccgttgtcgcctcgcaagtggaaaaagcgctcgccggcttgacgccggatcaagtgaag
caagcggtcatcgcttacgagccgatttgggcgatcggcacgggcaaatcgtcgacggcg
gaagatgcgaacgaagtgtgcggccatatccgttcggtcgtttcgcgcctgtttggcccg
gaggcggcggaagcgatccgcatccaatacggcggcagcgtcaaaccggacaacatccgc
gacttcttggcgcaagaacatatagacggcgccttagtcggcggggcgagcctcgagccg
gcttcattcttgcaattggtggaggcggggcgccatgagtaa

DBGET integrated database retrieval system