KEGG   Geobacillus sp. C56-T3: GC56T3_3328Help
Entry
GC56T3_3328       CDS       T01245                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
gct  Geobacillus sp. C56-T3
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:gct00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:gct00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3502834..3504138)
Genome map
AA seq 434 aa AA seqDB search
MEKIIVRGGNRLSGTVKVEGAKNAVLPVIAATLLATKGTSTIHDVPALSDVYTISEVLRY
LGADVHIAGETVTVDATGPLTVEAPFEYVRKMRASVLVMGPLLARNGRARVALPGGCAIG
SRPIDQHLKGFEAMGASVKVGNGFIDAEVNGRLRGAKIYLDFPSVGATENIMMAAVLAEG
TTVIENCAKEPEIVDLANFLNAMGAKVRGAGTGTIRIEGVDELVGTTHTVIPDRIEAGTF
MVAAAITGGNVLVQGAVPEHLGSLIAKLEEMGVTVMEEESGLRVIGPEKLKAVDIKTMPY
PGFPTDMQSQMMALLLKAEGTSMITETVFENRFMHVEEFRRMNADIKIEGRSVIINGPCQ
LQGAEVAATDLRAAAALILAGLAADGYTRVTELRHLDRGYVRFHEKLAALGADIERVREE
TEQFDQIQTIQWNG
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaagatcatcgtccgtggcggaaaccggttgagcggcaccgtcaaagtggaaggc
gcaaaaaatgccgttttgcctgtcatcgctgccactttattggctacgaaaggaacaagt
acgattcatgatgtgcctgctctttccgatgtatatacaatcagtgaagtgctccgctat
ttaggcgccgatgtgcacattgccggcgagacggtcaccgtcgatgccaccggtccgttg
acggtggaagcgccgtttgaatatgtgcgaaaaatgcgcgcgtcggtgcttgtcatgggg
ccgctgttggcgcgcaacggccgagcccgcgtggcgctgccgggcggctgtgccattggc
tcgcgcccgatcgatcaacatttaaaaggatttgaagcgatgggcgcgtctgtgaaagtc
ggcaatggctttatcgatgcggaagtgaacggacggctccgcggcgccaaaatttatttg
gactttccaagcgtcggggcgacggaaaacattatgatggccgccgtgctcgcggaaggc
acgactgtgatcgaaaactgcgccaaagagccggaaatcgtcgatttggcgaactttttg
aacgcgatgggcgccaaagtgcgcggcgccggcaccggaacgattcgaatcgagggagtt
gacgagctcgtcggcacaacgcatacggtcattccggaccgcatcgaagccggcacgttt
atggtggcggcggcgatcaccggcggcaatgtcctcgtgcaaggagccgttccggaacat
ttaggctcgctgatcgccaaactcgaagaaatgggcgtgaccgtcatggaagaggaaagc
ggcttgcgtgtcatcggtccggaaaagctgaaagccgtcgacattaaaacgatgccatat
ccgggctttccaaccgacatgcagtcgcaaatgatggctctcttgttgaaagcggaaggc
acgagcatgatcaccgagacggtgtttgaaaatcgctttatgcatgtggaggaattccgg
cgcatgaacgccgatattaaaattgaggggcgttccgtcattatcaatggcccgtgccag
ctgcaaggcgccgaagtggcggccaccgatttgcgcgcagcggcggcgttgattttggct
ggactcgcggcggacggctacacgcgcgtgaccgagcttcgtcatctcgaccgcgggtat
gtccgcttccacgaaaagttggctgcgcttggggccgacattgaacgcgtccgcgaagaa
acggaacaattcgaccaaattcaaacgatccaatggaacggataa

DBGET integrated database retrieval system