KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_0049Help
Entry
GDI_0049          CDS       T00631                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:gdi00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:gdi00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(55390..56355)
Genome map
AA seq 321 aa AA seqDB search
MTDGPRAAAPRFFPQHARHLLGLQGMHPTRIEPFLDLAESYALMSRSRKTPRDRLLGRTV
INLFFEDSTRTRTSFELAAKRLGADVINMTVASSSVNKGETLLDTAATLNAMRTDLLVVR
HSQSGAPALLARKVEASVVNAGDGTHEHPTQALLDALTIRRHFGTLHGLTVAICGDVSHS
RVARSNIHLLTAMGARVRVVGPPTLIPGAIGALGVDVHYTMEDGLRDVDVVMMLRMQRER
MSGGQVPSAREYFRFYGLDRKRLAVARPGALVMHPGPMNRGVEIDSRVADSDQSVIREQV
EMGVAVRMAVLDLLSRAGDQS
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacggtccgcgcgcggcggcaccccgcttcttcccgcagcatgcacggcatctg
ctgggcctgcagggcatgcatccgacccggatcgaaccgttcctggacctggccgaaagc
tatgcgctgatgagccgctcgcgcaagacgccgcgcgaccggctgctggggcgcacggtc
atcaacctgttcttcgaggacagcacccggacgcggacgtcgttcgaactggcggcgaag
cggctgggcgccgacgtgatcaacatgacggtggccagttcgtcggtgaacaagggcgag
actctgctggacacggcggcgacgctgaacgcgatgcggaccgacctgctggtggtgcgc
cattcgcagtccggcgcgccggcgctgctcgcccgcaaggtcgaggccagcgtggtgaat
gccggcgacggcacccacgaacaccccacccaggcgctgctggacgcgctgaccatccgc
cggcatttcggcacgctgcacggcctgacggtggcgatctgcggcgatgtcagccacagc
cgcgtggcacggtcgaacatccacctgctgacggcgatgggggccagggtacgggtggtg
ggaccgcccacgctgatccccggcgcgatcggcgccctgggggtggatgtccattacacg
atggaagacgggctgcgcgacgtggacgtggtgatgatgctgcgcatgcagcgcgagcgc
atgagcggcggccaggtgcccagcgcgcgcgaatatttccgcttctacggcctggaccgc
aagcggctggcggtcgcgcggcccggggcgctggtcatgcatcccggcccgatgaatcgc
ggggtcgagatcgacagccgcgtcgccgattccgaccagagcgtcatccgcgagcaggtc
gagatgggggtggccgtgcgcatggccgtcctggacctgctgtcgcgtgccggagatcag
tcgtga

DBGET integrated database retrieval system