KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_0165Help
Entry
GDI_0165          CDS       T00631                                 

Gene name
cysG
Definition
siroheme synthase
Orthology
K02302  
uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:gdi00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(173540..174952)
Genome map
AA seq 470 aa AA seqDB search
MSDATDPGWFPLALRLRGARVVVVGGGGIALNKVRLLLAHAARIDILAPRLEDTLAAWQA
EGRITHIAGEATPDRVRALLPGSRLVYAATDDRAVNRAVAAQADALNIPVCAVDDPEPSS
FITPAQIHRGPVRIAISTGGAAPVLARRLRERIEAVMPAGLDALARFLQAERAHVVAACP
DIGRRRRVWEDFLDGPGGEAAQRGEHAAARQVLDHLLAGAQTGGEVWLVGAGPGDPDLLT
LRALHLMQNADSVLYDQLLPPALMDRVRRDAERVFVGKQRDRHTMPQDDINAELIRRARA
GERVLRLKGGDPFIFGRGGEEIEALMAAGIPFQVVPGITAASGCAAYAGIPLTHRDCAQS
CLFVTGHARRDGTLDLPWDSMARPGQTIAIYMGVTALPDLCTMLVRHGLPPDWPAAVVER
GTRPDQRVLTGTLADLPALARAHAVGSPALVLVGQVVRHRVVTPPPLSGT
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatgcgaccgaccccggctggttcccgctggcgctgcggctgcgcggcgcgcgg
gtggtggtggtgggcggcggcgggatcgcgctgaacaaggtccggctgctgctggcccac
gccgcgcggatcgacatcctggccccccggctggaggacacgctggccgcctggcaggcc
gaagggcggatcacccacatcgcgggcgaggcgacgcccgaccgggtgcgtgcgctgctg
cccggcagccgcctggtctatgccgcgaccgacgaccgggcggtgaaccgcgccgtcgcg
gcgcaggccgatgcgctgaatatcccggtctgcgcggtggacgacccggagccgtcttcc
ttcatcacgcccgcgcagatccatcgcgggccggtgcggatcgcgatttccaccggcggc
gcggccccggtgctggcccggcgcctgcgcgagcggatcgaggccgtgatgccggcaggg
ctcgacgcgctggcgcgcttcctgcaggccgagcgcgctcatgtcgtggctgcctgcccc
gatatcggccgccgccgccgggtatgggaggatttcctggacggcccaggcggcgaggcg
gcgcagcgcggcgaacacgcggccgcgcgacaggtactggaccacctgctggccggcgcg
cagaccgggggcgaggtctggctggtcggcgccgggccgggggacccggacctgctgacc
ctgcgggcgctgcacctgatgcagaacgcggattcggtgctgtacgaccagttgctgccg
cccgcgttgatggaccgggtgcgccgcgatgccgagcgggtgttcgtgggcaagcagcgc
gaccgccacaccatgccgcaggacgacatcaatgccgaactgatccgccgcgcgcgggcg
ggcgagcgggtgctgcgcctgaagggcggggacccgttcatcttcggtcgcggcggcgag
gagatcgaggccctgatggcggcgggaattccgttccaggtcgtgccgggcatcacggcg
gccagcggctgcgccgcctatgccggcattccgctgacccaccgggactgcgcccagtcc
tgcctgttcgtcaccggtcacgcccgccgcgacggcacgctggacctgccgtgggacagc
atggcccggccggggcagaccatcgcgatctatatgggcgtcaccgcgctgccggacctg
tgcaccatgctggtgcgccacggcctgccgcccgactggcccgccgccgtggtggagcgc
ggcacccggcccgaccagcgcgtgttgacgggaaccctggccgacctgccggcgctggcg
cgcgcccatgccgtgggcagcccggcgctggtgctggtgggccaggtggtgcgccaccgc
gtcgtcacgccgccgcccctgtccggtacgtga

DBGET integrated database retrieval system