KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_0586Help
Entry
GDI_0586          CDS       T00631                                 

Gene name
mtnD
Definition
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:gdi00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
590464..591003
Genome map
AA seq 179 aa AA seqDB search
MSHLTVYRDDDPDDIVLRTDDAAVIADALRGIGARFERWDSPVVPPLDATPDAVLNTYRP
YLDELMGETGAGSADVVRINAATPNLTALRDKFLSEHTHSEDEVRFFVHGSGNFVLHVDG
RVYDVCCTAGDLISVPRGTPHWFDAGLSPDVVALRVFTDTTGWIADYTGDDIARRFPVS
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgagccacctgaccgtctatcgcgacgacgacccggacgacatcgtcctgcggaccgac
gacgcggccgtcatcgccgacgcgttgcgcggcatcggtgcgcgcttcgaacgctgggac
agccccgtggtgcccccgctcgacgccacgcccgacgcggtgctgaacacctaccgcccc
tatctggacgagctgatgggtgagaccggggcagggtccgccgacgtggtgcgcatcaac
gccgccacccccaacctgacggccctgcgcgacaagttcctctccgaacatacgcatagc
gaggacgaggtccggttcttcgtccatggcagcggcaatttcgtgctgcatgtcgacggc
cgggtctatgacgtgtgctgcacggccggcgacctgatctcggtcccccgggggacgccc
cactggttcgatgccgggctgtctcccgacgtggtggcgctgcgcgtgttcaccgacacg
accggctggatcgcggattatacgggcgacgacatcgcccggcgctttcccgttagctga

DBGET integrated database retrieval system