KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_0606Help
Entry
GDI_0606          CDS       T00631                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gdi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    GDI_0606
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    GDI_0606
Enzymes [BR:gdi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     GDI_0606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
613283..615313
Genome map
AA seq 676 aa AA seqDB search
MPLPASAHYSGQTLSLANGLAVQWDHAPTPLLRRAADRLRARLDRLAGRVLPADDHASGA
AMLRVRYGADPSFLALGEKEQYRLAVRPDGITLDAAGPAGVLDGFATLAQLAAQGPQGPV
LMQADIDDRPRFPWRGIMIDVSRHFMRIETLHRQIDAMEQVKLNVLHLHLGDSQGFRVES
RLFPGLQRQGSHGQFYTQAQIRDLVAYAADRGVRIVPEFDTPGHALAILLAYPALAAQPV
DPAMPDPDDAALNPTLDATLHFVTQLYGEMGRLFSDRYFHAGGDEVQAEQWTRNPKITAF
MKAHGFADTASLQAAFTARVQSVLARQGKIMVGWDEVSAAPIPKSVVVEAWRSSKFIGTA
TRAGHPVVVSAGYYLDLLNPAEQHYRVDPLDVQASGLTRAQADIKRVTMGPLVDAFTLDP
TLPPLDAAQQKLVLGGEAPLWSELVTDETLMRACVPRAAAIAERFWSQPEIRDVDGMDRR
LTEVASRLEVTGLQARANAYRMQARLAPADPGAVACLMGAVMPVRNYALNSFVRRSGQVR
FDELAEIASPDPIAAMRFNALAARFAAGDRGVAEALRAQLGAWAACGDRFATVAQGVGAL
EQGLPVARDIAALARIGLAALSGPLDDAQRRDAVARIAADQAVVESFAGVVRTHGVKPPP
AGLLVAILPGIRSLMG
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgccgctgcccgcctcggcgcattattccggccagaccctgtccctggccaacggcctg
gccgtgcagtgggaccacgcgccgacacccctgctgcgccgcgcggccgatcggctgagg
gcacgcctggaccggctggccggccgggtgctgccggccgacgaccacgcgtcgggggcc
gcgatgctgcgggtccgctacggggccgacccgtccttcctcgccctgggcgagaaggag
cagtaccgcctggccgtccgtccggacggcatcacgctggacgccgccggtcccgccggg
gtgctggacgggttcgccaccctggcgcaactggcggcgcaggggccgcagggcccggtg
ctgatgcaggccgatatcgacgaccggccgcgctttccctggcgcggcatcatgatcgac
gtctcgcgccacttcatgcgcatcgagaccctgcatcggcagatcgacgcgatggagcag
gtgaagctgaacgtgctgcacctgcatctgggcgattcccagggatttcgggtcgaaagc
cggctgttcccgggcctgcagcggcaggggtcgcatggccagttctatacccaggcccag
atccgcgacctggtcgcctacgccgccgatcgcggcgtgcgcatcgtgccggaattcgac
acgcccggccacgcgctggccatcctgctggcctatcccgcgctggcggcccagccggtc
gatccggccatgccggaccccgacgacgcggcgctgaacccgacgctggatgccacgctg
cacttcgtcacgcagctatacggcgaaatggggcgcctgttctcggatcgctatttccat
gccggcggcgatgaggtgcaggccgaacaatggacccgcaatccgaagattacggcgttc
atgaaggcccacggcttcgcggacaccgcgtcgctgcaggcggcctttaccgcgcgggtg
caatccgtgctggcccgccagggcaagatcatggtgggctgggacgaggtcagcgcggcc
ccgattcccaaaagcgtggtggtcgaggcctggcggtcgtccaaattcatcggcaccgcc
acccgggcgggccacccggtcgtggtctcggccggctattatctcgacctgctgaacccg
gcggagcagcattaccgggtcgatccgctggacgtgcaggccagcggcctgacccgcgcg
caggccgatatcaagcgcgtgacgatgggccccctggtggacgccttcacgctcgacccc
accctgccgccgctggatgccgcgcagcagaagctggtgctgggcggcgaggccccgctg
tggagcgaactggtcacggacgaaacgctgatgcgcgcctgtgtgccgcgcgccgccgcc
atagccgagcggttctggtcgcagccggagatccgcgatgtcgatggcatggatcgccgc
ctgacggaggtggcgagccgcctggaggtgaccggcctgcaggcgcgggcgaacgcctat
cggatgcaggcccgcctggcgcccgccgatcccggggcggtcgcctgcctgatgggtgcc
gtgatgccggtgcgcaattacgccctgaacagcttcgtccggcgcagcggccaggtgcgg
ttcgacgaactggcggaaatcgcatcccccgaccccatcgccgcgatgcggttcaacgcg
ctggccgcgcgcttcgccgccggggatcgcggcgtggcggaggcgttgcgggcgcaactc
ggcgcgtgggccgcgtgcggggatcgcttcgccacggtcgcgcagggcgtgggcgcgctg
gaacagggcctgccggtggcgcgggacatcgcggccctggcccgcatcgggctggccgcc
ctgtccggccccctggacgacgcgcagcgccgcgatgccgtggcacggatcgcagccgac
caggcggtggtcgagtcgtttgccggcgtggtgcggacccacggcgtgaaaccgccgccc
gccgggctgctggtggcgatcctgcccgggatcaggtccctgatggggtag

DBGET integrated database retrieval system