KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_0728Help
Entry
GDI_0728          CDS       T00631                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gdi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GDI_0728
Enzymes [BR:gdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     GDI_0728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
747054..747971
Genome map
AA seq 305 aa AA seqDB search
MTDPTGTGTLHESAHAKINLYLHVTGRRPDGYHLLDSLAVFAGAADRLTLRPGAAGQGEA
VALDIAGAFGAGLVADTDSNLVLQAARRLRAEMGVTDRLAPMRIVLEKSLPVASGIGGGS
ADAAAALRLLLRAWPGEALPRARLMALAVELGADVPVCIDQRAARMGGVGERLAPAPALP
NCGMMLVNCGEAVPTPAVFRARAPVFTPAASLPSAWPDVGAMVRDLAALTNDLQDAACEL
CPTIRTVLQVLDAAPGCRLARMSGSGATCFALFDSPQGARDAMTAVERPGWWVWAGGLHG
MPAET
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtgactgatccgacagggactggaacgctgcacgaatccgcccatgcgaaaatcaacctc
tacctgcatgtaacggggcgccggccggacggatatcacctgctggacagcctggcggtc
ttcgcaggggcggcggaccgcctgaccctgcgtcccggtgcggcgggccagggggaagcg
gtggccctggacattgccggcgcgttcggcgccgggctggtggccgataccgacagcaat
ctggtgctgcaggcggcgcgcaggctgcgggcggaaatgggggtcaccgaccggctggcc
cccatgcggatcgtgctggaaaaatcactgcccgtcgcatcgggaatcggcggcgggtcg
gcggacgcggcggcggcgctgcgcctgctgctgcgggcctggccgggcgaggcactgccc
cgcgcgcggctgatggccctggcggtcgaactgggggccgatgtcccggtctgcatcgac
cagcgcgcggcccggatgggcggcgtgggcgaaagactggcccccgcgccggcgctgccg
aactgcggcatgatgctggtgaattgcggcgaggccgtgccgacccccgccgtgttccgc
gcgcgggcgcccgtcttcaccccggcggccagcctgccgtccgcgtggccggatgtcggg
gcgatggtgcgcgacctggcggcgctgaccaacgacctgcaggatgcggcctgcgagctc
tgcccgaccatccgcacggtcctgcaggtgctggacgccgcgccgggctgccggctggca
aggatgagcggttcgggcgccacctgcttcgccctgttcgacagcccgcagggggcacgc
gacgcgatgacggcggtcgaacgccccggatggtgggtatgggccggcggcttgcatgga
atgccggcggaaacctga

DBGET integrated database retrieval system