KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_0745Help
Entry
GDI_0745          CDS       T00631                                 

Gene name
glcE
Definition
glycolate oxidase subunit
Orthology
K11472  
glycolate oxidase FAD binding subunit
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gdi00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    GDI_0745 (glcE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
763141..764361
Genome map
AA seq 406 aa AA seqDB search
MSILADPIVYRPTRAPDVAEMVRAACSKGQALAIAGNGTRHGLGNPVAAAVRLEVGGLRT
VHFYEPDDLVIRVDAGLPLAELTAILAEHRQYLPFEPPVHAVLYGTDPARATIGGAIGTG
LSGPRRFQAGAARDFVLGVEGVNGQGDSFSAGGRTMKNVTGYDLPKLVTGAFGTLAVLTS
VTLKVLPAPPEERTLLLPSAGLAGDIARMATVLAQPLAVTGAAVVPDGDGRVIALRVEGS
RPAVTDHMGRLADPVSGLPPGRMLEGPASTAFWTGVRELVPLAAGPDDWLWRIHLPATAA
AGLADRLRGEGLVASLMLDWGGALLFCAMKPGREDSVTRLRALAAAVAGRAILIRAPDAV
RAAHGAFPAPDPAVRALSERTRRVFDPAGILNPGRMTPPAQEDAAC
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcctggccgaccccatcgtctaccgccccacccgggcccccgacgttgccgaa
atggtgcgggccgcctgctccaaggggcaggcgctggcgatcgcgggcaacggcacgcgg
cacggtctgggcaaccctgttgccgctgccgtgcggctggaagtgggcggactgcgtacg
gtgcatttctatgaacccgacgatctggtcatccgcgtcgatgccggactgcccctggcc
gaactcacggcgatcctggccgaacaccgccagtacctgcccttcgagccgccagtccat
gccgtgctgtacggcaccgatccggcacgggcgacgatcggcggcgcgatcggcaccggc
ctgtcgggtccccgccggttccaggccggggccgcgcgcgatttcgtcctgggggtcgaa
ggggtgaacggccagggtgactccttctccgcaggcggccggacgatgaagaacgtcacc
ggatatgatctgccgaaactggtgaccggcgcgttcggaaccctggcggtgctgaccagc
gtgaccctgaaggtgctgcccgccccgcccgaggaacggacgctgcttctgccctcggcg
ggactggccggcgatatcgcgcgcatggccacggtcctggcgcagccgctggccgtgacc
ggcgcggccgtcgtgccggacggcgacggcagggtcatcgccctgcgggtcgaaggcagc
cggcccgccgtgaccgaccacatgggccgcctggccgatccggtatccggcctgcccccc
ggacggatgctggagggaccggccagcaccgccttctggaccggggtgcgggaactggta
cccctggcggcagggcccgacgactggctgtggcgcatccatctgcccgcgacggcggcg
gccggcctggccgaccggctgcggggcgagggactggtcgccagcctgatgctggattgg
ggcggcgcgctgttgttctgcgcgatgaagcccggccgggaagacagcgtgacccggctg
cgcgccctggcggcggcagtggccggacgggcgatcctgatccgcgcgccggacgccgtt
cgcgctgcccatggcgcgttccccgcgcccgatccggcggtgcgcgcgctgtccgaacgg
acgcgccgcgtcttcgatccggccggaatcctcaatcccggccgcatgaccccgccggcg
caggaggacgcggcatgctga

DBGET integrated database retrieval system