KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_0800Help
Entry
GDI_0800          CDS       T00631                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gdi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    GDI_0800 (ruvA)
Enzymes [BR:gdi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     GDI_0800 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
818886..819488
Genome map
AA seq 200 aa AA seqDB search
MIAHLTGLVGQMESDRCVVDVGGVGYLVHASTRTLSALPRPPDVTRVLVETVVREDAFLL
YGFAEAAERDWFRLLTTVQGVGAKVALAILSALSPGDLAGVIAAADKASLTRVSGVGARL
AERILTELRDKAGRMPAGPGVTIAAPPASGGVEADALLALAGLGFRRAEAQPVVGRILAR
LDGKADLDVVIRESLRELAR
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcgcacctgaccgggctggtggggcagatggaatccgaccgctgcgtggtcgat
gtcggcggcgtcggctatctggtccatgcctccacccgcacgctctcggcgctgccccgt
ccgcccgatgtgacccgcgtcctggtcgagaccgtggtgcgcgaggatgccttcctgctc
tacggctttgcggaagccgcggagcgcgactggttccgcctgctgacgacggtccagggg
gtgggggcgaaggtcgcgctggccattctctccgccctgtcgccgggcgacctggccggg
gtgatcgcggcggcggacaaggccagcctgacccgggtgtcgggtgtcggcgcgcggctg
gccgagcgcatcctgaccgaactgcgcgacaaggccgggcgcatgcccgccgggccgggc
gtgacgatcgcggcccccccggcctcgggcggggtggaagccgatgccctgctggcgctg
gcgggcctgggcttccgccgggccgaggcccagccggtggtggggcgcatcctggcgcgc
ctggacggcaaggcggacctggatgtcgtgatccgcgaaagcctgcgggaacttgcccga
tga

DBGET integrated database retrieval system