KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_0811Help
Entry
GDI_0811          CDS       T00631                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:gdi00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
829872..830972
Genome map
AA seq 366 aa AA seqDB search
MGAGKREGWMDCLRLIEPVGLVLGRQAHVAVAAGLAHWLAGGPAAFTLARLIDGDDVRLV
RAGDIPPGWLPVLARVTAPLPSADLPDGPRVMGILNVTPDSFSDGGRHMGPDAALRAAAA
MVEAGAALLDIGGESTRPDAAVVTPDEEWARIAPVLADLHGRTGAVLSVDTRNARTMASA
LGLGATLINDVSALAHDPDALGVVADAGCPVVLMHMRGTPQTMSRLATYGDVGADVTREL
AARIDAAVAAGVARHRILVDPGIGFAKTTAQNAALLGRLPILANLGCRIVLGTSRKRTLG
ELAGVQVAADRDPGTVASTLPGLELGNTILRVHNVPAMVQALRVWQGVWTCDKPASGPAM
AGQNQG
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
ttgggcgcagggaaacgggaaggctggatggattgtcttcggttgatcgaacccgtgggg
ctggtcctggggcggcaggcgcatgtggccgtggcggcgggactggcccactggctggcc
ggtgggccggcggcctttaccctggctcggctgatcgacggggacgatgtccgcctggtc
cgcgcgggcgatattccgcccggctggctgccggtcctggcccgtgtgacggcgccgctg
ccgtcggcggacctgccggacgggccgcgggtgatgggcatcctgaacgtgacgccggac
agcttcagcgacggtggccgccatatgggaccggacgccgcattgcgtgccgcggcggcc
atggtggaagccggtgccgcgctgctggatatcggcggcgagagcacgcggcccgacgcc
gccgtggtgacgccggacgaggaatgggcccgcatcgctccggtgctggcggacctgcac
ggccggaccggggccgtactgtcggtcgacacccgcaacgcccgtaccatggcctccgcg
ctggggctgggggcgacgctgatcaacgatgtctcggcgctggcgcatgacccggatgcg
ctgggggtggtggcggatgccgggtgccccgtggtgctgatgcatatgcgcggcacgccg
cagacgatgtcgcgccttgcgacctatggcgacgtgggcgccgacgtgacgcgcgaactc
gccgcgcgaatcgacgcggccgtggccgccggtgtcgcgcgccatcgcatcctcgtcgat
cccggcatcggcttcgccaagaccacggcgcagaatgccgcattgctgggccggttgccg
atcctggcgaacctggggtgccgtatcgtgctgggaacgtcgcgcaagcgcacgctgggg
gaactggccggggtgcaggtggccgccgaccgcgatccggggaccgtggccagcaccctg
ccgggcctggaactcggcaacacgatcctgcgtgtacataacgtgccggccatggttcag
gccctgcgggtctggcagggcgtgtggacctgcgataagccggcatcagggcccgccatg
gcagggcagaaccagggatag

DBGET integrated database retrieval system