KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_1219Help
Entry
GDI_1219          CDS       T00631                                 

Definition
GDSL-like lipase/acylhydrolase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:gdi00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    GDI_1219
Enzymes [BR:gdi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     GDI_1219
   3.1.2  Thioester hydrolases
    3.1.2.-  
     GDI_1219
Lipid biosynthesis proteins [BR:gdi01004]
 Fatty acid synthase
  Component type
   GDI_1219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1210892..1211524
Genome map
AA seq 210 aa AA seqDB search
MARALFLWLILLPAAAMPARAADRPIRVLALGDSLTAGYGLAHADSFVPRLQAALDEKGG
GITILDGGVSGDTSADALARLDWALGDAPDAAIVELGGNDGLRGLEPARMERNLTAILDR
LRQAHVPVLLSGMYAPPNMGASYGQSFRAVFDRLSHRPGIMWDPFFLKGVAAHPELEQPD
HIHPNPAGVGVIVQRLAPLVERLAQDARRS
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggcccgagccctttttctgtggctgatcctgctgccggcggccgcgatgcccgcccgg
gccgccgaccggccgatccgggtcctggcgctgggggattcgctgacggccggttacggc
ctggcgcacgccgacagcttcgtgccgcgcctgcaggcggcgctggacgaaaaggggggc
ggcatcactatcctggatggtggcgtgtcgggcgataccagcgcggatgcgctggcacgg
ctggactgggcgctgggcgatgcgcccgatgccgcgatcgtggaactgggcggcaatgac
gggctgcgggggctggagcccgcgcggatggaacggaacctgaccgccattctcgaccgg
ttgcggcaggcgcatgtgccggtgctgctgtcgggcatgtacgcaccgccgaacatgggc
gcgtcctacggccagtccttccgcgccgtgttcgaccggctgtcgcaccggcccggcatc
atgtgggacccgttcttcctgaagggcgtggcggcgcatcccgaactggagcagccggac
cacatccaccccaatccggccggtgtcggcgtcatcgtgcagcgcctggccccgttggtg
gaacgtctggcgcaggatgcgcggcggtcctga

DBGET integrated database retrieval system