KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_1417Help
Entry
GDI_1417          CDS       T00631                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase E2 component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gdi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GDI_1417 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GDI_1417 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    GDI_1417 (sucB)
Enzymes [BR:gdi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     GDI_1417 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1419528..1420958
Genome map
AA seq 476 aa AA seqDB search
MAVSFRLQSGYVERCTSRQTTGEGHASHVLVGGMRSRSSARGSVRQGEWKETMSAEIKVP
TLGESVTTATIAKWLKKPGEAVTADEPVVELETDKVSVEVAAPEAGVMGPQLVAEGDEVE
VGTVLASVEAGSGAAAKPAAAAPAPKKAAEAPKAPAGVQAQPTTSGPVARPATPPSDVAA
QGAAHAPMPSAQKMMTEKGVTTAEIGIGTGKDGRVTKGDVLAFLSQPPVAKAAAAPAAPR
TDDPREERVKMTRLRRTIARRLKDAQNTAALLTTFNEVDMSAAKAMRAEYRDLFEKKNGG
VKLGFMSIFAKAAIAALKEFPAINAEIDGDDVIYREFINLGIAVGGPNGLVVPVIRDADK
LNFAGIESAIAGFGKRARDGSLKLDELSGGTFSITNGGIYGSLMSTPIVNAPQSGILGMH
AIQDRPVAVNGQVVIRPMMYIALTYDHRIVDGKEAVSFLVRVKQNVEDPRRLLLEV
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgtcgttccggcttcagtccggttatgttgaaaggtgcacaagccggcagacg
acgggcgaggggcatgcgagccatgtcctggtcgggggcatgcggtcccggtccagcgcg
cgcggatctgtccggcagggggaatggaaagaaacgatgtctgccgagatcaaggtcccg
actctgggcgagagcgtgacgaccgccacgattgcgaaatggctgaagaagcccggtgaa
gcggtgacggccgacgaaccggtggtggaactggagaccgacaaggtcagcgtcgaggtc
gcggcgcccgaagccggcgtgatgggcccgcaactggtggccgagggtgacgaggtcgag
gtcggcaccgtcctggcctcggtcgaggccggcagcggcgccgccgccaagcccgcggcc
gctgccccggcgccgaagaaggccgccgaggccccgaaggccccggccggcgtgcaggcc
cagccgaccaccagcggccccgtcgcccgtcccgcgacgccgccgtccgacgtcgcggcc
cagggggcggcccatgcgccgatgccgtcggcccagaagatgatgaccgaaaagggcgtg
acgaccgccgaaatcggaatcggcaccggcaaggacggacgcgtgaccaagggtgatgtc
ctggccttcctgtcgcagccgccggtggccaaggccgccgcggccccggccgccccgcgc
accgacgacccgcgcgaggaacgggtgaagatgacccgcctgcgccggaccatcgcccgc
cgcctgaaggacgcgcagaacaccgccgccctgctgaccaccttcaacgaggtggacatg
tcggcggccaaggcgatgcgcgccgaatatcgcgatctgttcgagaagaagaacggcggc
gtgaagctgggcttcatgtcgatcttcgccaaggcggccatcgcggcgctgaaggaattc
ccggcgatcaacgcggaaatcgacggcgacgacgtgatctatcgcgaattcatcaatctc
ggcatcgcggtcggcggcccgaacgggctggtcgtgccggtcatccgcgacgcggacaag
ctgaacttcgcggggatcgaaagcgcgatcgcgggcttcggcaagcgtgcgcgtgacggg
tcgctgaaactggacgaactgtcgggcggcacgttctcgatcaccaacggtggcatctac
ggttcgctgatgtccacgccgatcgtcaatgccccgcagtcgggcatcctgggcatgcat
gccatccaggaccgtccggtcgccgtgaacggccaggtcgtgatccggccgatgatgtac
atcgccctgacctacgatcaccgcatcgtcgacggcaaggaggctgtcagcttcctggtg
cgcgtcaagcagaacgtggaagacccgcgtcgtctgctgctcgaggtctga

DBGET integrated database retrieval system