KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_1417Help
Entry
GDI_1417          CDS       T00631                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase E2 component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:gdi01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:gdi00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:gdi00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1419528..1420958
Genome map
AA seq 476 aa AA seqDB search
MAVSFRLQSGYVERCTSRQTTGEGHASHVLVGGMRSRSSARGSVRQGEWKETMSAEIKVP
TLGESVTTATIAKWLKKPGEAVTADEPVVELETDKVSVEVAAPEAGVMGPQLVAEGDEVE
VGTVLASVEAGSGAAAKPAAAAPAPKKAAEAPKAPAGVQAQPTTSGPVARPATPPSDVAA
QGAAHAPMPSAQKMMTEKGVTTAEIGIGTGKDGRVTKGDVLAFLSQPPVAKAAAAPAAPR
TDDPREERVKMTRLRRTIARRLKDAQNTAALLTTFNEVDMSAAKAMRAEYRDLFEKKNGG
VKLGFMSIFAKAAIAALKEFPAINAEIDGDDVIYREFINLGIAVGGPNGLVVPVIRDADK
LNFAGIESAIAGFGKRARDGSLKLDELSGGTFSITNGGIYGSLMSTPIVNAPQSGILGMH
AIQDRPVAVNGQVVIRPMMYIALTYDHRIVDGKEAVSFLVRVKQNVEDPRRLLLEV
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgtcgttccggcttcagtccggttatgttgaaaggtgcacaagccggcagacg
acgggcgaggggcatgcgagccatgtcctggtcgggggcatgcggtcccggtccagcgcg
cgcggatctgtccggcagggggaatggaaagaaacgatgtctgccgagatcaaggtcccg
actctgggcgagagcgtgacgaccgccacgattgcgaaatggctgaagaagcccggtgaa
gcggtgacggccgacgaaccggtggtggaactggagaccgacaaggtcagcgtcgaggtc
gcggcgcccgaagccggcgtgatgggcccgcaactggtggccgagggtgacgaggtcgag
gtcggcaccgtcctggcctcggtcgaggccggcagcggcgccgccgccaagcccgcggcc
gctgccccggcgccgaagaaggccgccgaggccccgaaggccccggccggcgtgcaggcc
cagccgaccaccagcggccccgtcgcccgtcccgcgacgccgccgtccgacgtcgcggcc
cagggggcggcccatgcgccgatgccgtcggcccagaagatgatgaccgaaaagggcgtg
acgaccgccgaaatcggaatcggcaccggcaaggacggacgcgtgaccaagggtgatgtc
ctggccttcctgtcgcagccgccggtggccaaggccgccgcggccccggccgccccgcgc
accgacgacccgcgcgaggaacgggtgaagatgacccgcctgcgccggaccatcgcccgc
cgcctgaaggacgcgcagaacaccgccgccctgctgaccaccttcaacgaggtggacatg
tcggcggccaaggcgatgcgcgccgaatatcgcgatctgttcgagaagaagaacggcggc
gtgaagctgggcttcatgtcgatcttcgccaaggcggccatcgcggcgctgaaggaattc
ccggcgatcaacgcggaaatcgacggcgacgacgtgatctatcgcgaattcatcaatctc
ggcatcgcggtcggcggcccgaacgggctggtcgtgccggtcatccgcgacgcggacaag
ctgaacttcgcggggatcgaaagcgcgatcgcgggcttcggcaagcgtgcgcgtgacggg
tcgctgaaactggacgaactgtcgggcggcacgttctcgatcaccaacggtggcatctac
ggttcgctgatgtccacgccgatcgtcaatgccccgcagtcgggcatcctgggcatgcat
gccatccaggaccgtccggtcgccgtgaacggccaggtcgtgatccggccgatgatgtac
atcgccctgacctacgatcaccgcatcgtcgacggcaaggaggctgtcagcttcctggtg
cgcgtcaagcagaacgtggaagacccgcgtcgtctgctgctcgaggtctga

DBGET integrated database retrieval system