KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_1442Help
Entry
GDI_1442          CDS       T00631                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:gdi00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:gdi00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(1445090..1446352)
Genome map
AA seq 420 aa AA seqDB search
MDRFIIHGGHRLRGDIVIGGAKNAALKLLVAGLLTSERLVLRNVPRIADITTMRRLLEQH
GVTVEDLEGDGGTLAVGGTITNTEAPYDIVSQMRASILVLGPLLARCGEARVSLPGGCAI
GTRPVDMHLKGLEALGAEISLENGYINARAPRGLVGERIILPFASVGATENLLMASCLAR
GRTEIINAAREPEIADLVACLNGMGARITGTGTGSLAIEGVEALHGTTHRVMPDRIECGT
YACAAGITGGELRLIGGRADHLGAVVRALEEAGVEVFQEDDALRVRRTGALRGVDIMTEP
YPGFPTDMQAQFMALLSVAEGASMVTETIFENRFMHVPELNRMGARINVHGSSAIIRGVH
SLSGAPVMATDLRASFSLILAGLAAHGETILSRVYHLDRGYEAVEQKLARCGAQIERVRE
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggaccgtttcatcattcacggcggccaccggctgcgcggcgacatcgtcatcggcggc
gccaagaacgcggcgctgaagctgctggtcgcggggctgctgacctccgaacggctggtg
ctgcgcaacgtgccgcgcatcgcggacatcacgaccatgcgccggctgctggaacagcac
ggggtcacggtcgaggacctggagggcgacggcggcaccctggccgtcggcggcaccatc
acgaacaccgaggccccatacgacatcgtgtcgcagatgcgcgcctcgatcctggtgctg
ggcccgctgctggcgcgctgcggcgaggcccgggtgtccctgcccggcggctgcgccatc
ggcacccgcccggtggacatgcacctgaaggggctggaggcgctgggcgccgagatctcg
ctggaaaacgggtatatcaacgcccgcgcgccgcgcgggctggtgggcgaacgcatcatc
ctgccgttcgcctcggtcggcgccacggaaaacctgctgatggcgtcctgcctggcacgc
gggcggaccgagatcatcaatgcggcgcgcgagccggagatcgcggacctggtcgcctgc
ctgaacggcatgggcgcgcgcatcaccggcacgggtaccggctcgctggccatcgaaggg
gtcgaggcgctgcacggcacgacccaccgcgtgatgcccgaccggatcgaatgcggcacc
tatgcctgcgccgccgggatcacgggcggcgagctgcggctgatcggcggccgggccgac
catctgggcgcggtggtccgcgcgctggaggaagccggggtcgaggtgttccaggaggac
gacgccctgcgcgtgcgccgcaccggggcgctgcgcggcgtggacatcatgaccgagccc
tatcccggctttcccaccgacatgcaggcgcagttcatggccctgctgtcggtcgccgag
ggcgcgtcgatggtcaccgagaccatcttcgaaaaccggttcatgcacgtgccggaactg
aaccgcatgggcgcgcgcatcaacgtccatggttcgtccgcgatcattcgcggcgtgcat
tcgctgtcgggcgcgccggtgatggcgaccgacctgcgggcctcgttctcgctgatcctg
gcggggctggcagcgcatggcgagacgatcctgagccgcgtctatcacttggaccggggc
tacgaggccgtggaacagaagctggcgcgctgcggcgcgcagatcgagcgcgttcgggaa
tga

DBGET integrated database retrieval system