KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_1468Help
Entry
GDI_1468          CDS       T00631                                 

Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:gdi00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(1473140..1474681)
Genome map
AA seq 513 aa AA seqDB search
MFYGRINFEDLNLPLVITDEGLFGTSSYLRPFRHRLLFSEILISKNRIAIFNSERFSDEP
DGLLGEKFVPDESIDDRIKHYHLRFLDFSSIIINKDAETFSCHSSSVVYAPFFLKHDPDG
VSIDWDYQRLLKDTDAGIAWDVVLTQIQGIMPYGHRTVIEGVVRTTAGAILTASKNGIKT
ELPLPVHFSPPFDQIDSTGIERHFTDALEALLDARPLENRRTAVELSGGMDSALSAMVAK
NLLGHGLLSITAQFNGAMGVAQQERCATLIQAGGFDNLSLPAVRLAPFGETSLRRVRYGV
MPEDESYPEIFEESLSVAKAVGVDTLISGLGGDELYVIYEDEGGNGSGKKNSDCPFLTET
GLHYARDIHISYPTGWLAESCWYSSASRSQRLLRHGIWPVYPYQNLKLAQFISRLPYQYR
RDRNILRKSISMLLKNDMYEKSYIKETFDPVAMRGIRENKFYLMDLVERSRIANHPYINK
DNIISAVQQDFEEMDRDTYNYLFQTLKVLCFFQ
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
gtgttttacggacgaataaactttgaggatctcaaccttccccttgtcattactgacgag
gggctttttggaacctcatcctatctccgcccgtttcggcatcgtcttcttttttctgag
atattgattagcaagaatcgtatcgcgatttttaacagcgagcgattttccgatgaacca
gatggcttattaggcgaaaaatttgtccctgacgaatcaatagatgatagaataaagcat
tatcatctgagatttttggatttttcgtctataataataaataaagatgcagaaactttt
tcttgccactcgtcctccgtcgtttatgctccgttttttttaaagcatgatccagacggg
gtctctatcgactgggattatcagcgtctgttaaaagataccgatgcaggcattgcatgg
gatgtcgtacttacccagatccagggtattatgccctatggtcatcgcacggtcattgag
ggtgtcgttcgcacgaccgcaggcgcgatccttacggcgtcgaagaatggcataaaaaca
gaacttcccttacctgttcatttctcgcccccgttcgatcaaattgatagcaccggtatt
gaacgtcattttacagacgcccttgaagccctgttagacgctcgtcccctggaaaatcgc
cgaacggcagtggaattaagtggcgggatggattccgcgcttagtgcgatggttgcaaaa
aaccttcttggccatggcctgctgagcattacggcccaattcaacggtgcgatgggagtc
gcgcagcaagaaagatgcgccaccctgattcaggcaggtggcttcgacaatctcagcctt
ccggcagtacggcttgctcccttcggagagaccagtcttcgtcgggtccgctatggcgta
atgcccgaagatgaaagttatccggagatttttgaagaaagcctctctgttgcgaaagcc
gttggtgtggacacccttatttcaggattgggcggagatgagctatatgtaatatacgaa
gatgaaggtggaaacggttccggaaaaaagaattcggactgtccattccttactgaaact
ggcctgcattatgcacgcgatatccatatttcctatcccacaggatggcttgcggaaagt
tgctggtactcctccgccagcagatcccagcgcttgctgcgtcatggcatctggcctgta
tatccataccaaaacctgaagcttgctcaattcatatccagactgccttatcaatatcgg
cgtgaccggaatattttacgaaaatccatttccatgctcctcaaaaatgatatgtatgaa
aaaagttatataaaagagacttttgatccagtcgcgatgcgtgggatcagagaaaataag
ttctatctgatggatcttgtcgaaagatcgcggatagccaatcatccatacataaacaag
gataatattatttctgcagtacagcaggatttcgaggaaatggacagggatacgtacaac
tacctcttccaaactctcaaggtattatgtttctttcaataa

DBGET integrated database retrieval system