KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_1617Help
Entry
GDI_1617          CDS       T00631                                 

Definition
phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gdi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    GDI_1617
Enzymes [BR:gdi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     GDI_1617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(1624982..1627414)
Genome map
AA seq 810 aa AA seqDB search
MTSAPRMSVSEGTKMNEMSPLSTAPLTATPLSAAELGLFNRWWHAANYLSVGQIYLLANP
LLREPLKLEHTKPRLLGHWGTTPGLNFLYLHLNRIIRARDANILFIAGPGHGAPGVVANT
YLEGTYSEYFPEVSQDENGLGRLLKQFSFPGGIPSHAAATTPGSIHEGGELGYSLSHAYG
AVFDNPDLIVACVIGDGEAETGPLATSWHSNKFLDPQTDGAVLPILHLNGYKIANPTILA
RIPQPELEALLRGYGYDPIFVEGHDPDPMHQKMATAMDLAFDRIAAIQKAAREGGQTERP
TWPMIVMRSPKGWTGPKEIDGLRTEGYWRSHQVPFSDLTKPGHLQALETWLRSYKPEDLF
DESGRLFADIAALAPSGARRMSDNPHANGGQLRHPLKLPDIANYAVPVTTPGSVTGEGTR
VLGTWLRDVMKENLPSRNFRVLAPDENNSNRLNAVLDVTNRAWNAETVDYDDHLARDGHV
MEILSEHTCQGWLEGYLLTGRHGFMSCYEAFIHIVDSMVNQHAKWLKTSAEVPWRRSISS
LNYLLTSHVWRQDHNGFSHQDPGFIDHVINKKADIVRVYLPPDANTLLCTAAHCLHSWDR
INVIVAGKQPEPQWLSMEDAIRHCSAGIGIWEWASNDKGSEPDVVMACAGDVPTIETLAA
VKLLREHAPDLKIRVINVVDLMTLESASQHPHGLTDSAFDALFTLDKPVIFAFHGYPQLI
HKLIYRRANARNFHVHGFREEGSTTTPFDMVVRNHLDRFHIVSNVIDRVPGLATRAAYAK
QAIRDKLVDHTRYIAEYGRDMPEIEDWRWS
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atgacgtccgccccccgcatgtcagtttcggaaggaacgaagatgaacgagatgtccccc
ctgtccaccgcgcccctgacggccacgccgctgtcggcggcggaactcggcctgttcaac
cggtggtggcatgcggcgaactatctgtcggtgggccagatctacctgctggccaacccg
ctgctgcgtgaaccgctgaagctggaacataccaagccgcgcctgctgggccactggggc
acgaccccggggctgaacttcctctacctgcacctcaaccgcatcatccgcgcgcgggac
gccaacatcctcttcatcgccggtcccgggcatggcgcgccgggcgtcgtggccaatacg
tacctcgaaggcacgtacagcgaatatttccccgaggtgtcgcaggacgaaaacgggctg
ggccgactgctgaagcagttttccttccccggcggcattcccagccacgcggcggcgacg
accccgggctcgattcatgagggtggcgagctgggctactcgctctcgcacgcctatggc
gcggtgttcgacaatcccgacctgatcgtggcctgcgtcatcggcgatggcgaggccgag
accggtccgctggccacgtcgtggcacagcaacaagttcctcgacccgcagaccgacggc
gccgtgctgccgatcctgcacctgaacggctacaagatcgcgaaccccaccatcctggcc
cgcattccgcagcccgaactggaagcgctgctgcggggctacgggtacgatccgatcttc
gtcgaaggccacgaccccgacccaatgcaccagaagatggcgacggccatggacctggcc
ttcgaccggatcgccgcgatccagaaggcggcgcgcgagggcgggcagaccgaacgcccc
acctggccgatgatcgtcatgcgcagccccaagggctggaccgggccgaaggaaatcgac
ggcctgcggaccgaaggctactggcggtcgcatcaggtgccgttctcggacctgaccaag
cccgggcacctgcaggcgctggaaacctggctgcgcagctacaagcccgaggacctgttc
gacgaatccggccgcctgttcgccgacatcgcggccctggccccgtccggcgcacggcgc
atgagcgacaacccccatgccaatggcggacagttgcgccacccgctgaaactgccggac
atcgcgaactacgccgtgccggtcaccacgccgggcagcgtgacgggcgagggcacgcgc
gtgctgggcacgtggctgcgcgacgtgatgaaggaaaacctgccctcgcgcaatttccgt
gtcctggccccggacgaaaacaattccaaccgcctgaacgcggtgctggacgtcaccaac
cgcgcgtggaacgcggaaacggtggattatgacgaccacttggcgcgcgacggccatgtg
atggaaatcctcagcgagcacacctgccagggctggctggaaggctacctgctgaccggc
cgccatggcttcatgtcgtgctacgaggcgttcatccacattgtcgattcgatggtgaat
cagcatgcgaaatggctgaagacctcggccgaagtgccgtggcggcggtcgatttcctcg
ctgaactacctgctgacgtcgcatgtctggcgccaggaccataacggcttcagccaccag
gaccccggcttcatcgatcatgtgatcaacaagaaggccgatatcgtccgcgtgtacctg
ccgcccgatgccaacaccctgctctgcaccgccgcgcactgcctgcatagctgggaccgc
atcaacgtcatcgtggccggcaagcagccggaaccgcaatggctgagcatggaagacgcc
atccgccattgcagcgccggcatcggtatctgggaatgggccagcaacgacaagggcagc
gaaccagacgtggtgatggcctgcgccggcgacgtacccaccatcgaaacgctggcggcg
gtcaagctgttgcgtgagcacgcgccggacctgaagatccgcgtcatcaacgttgtggac
ctgatgacgctggaatcggccagccagcacccgcacggcctgacggattccgccttcgac
gcgctgttcacgctggacaagccggtcatcttcgccttccatggctatccgcagctgatc
cacaagctgatctaccgccgcgccaacgcccggaacttccacgtccacggcttccgcgag
gaaggatcgaccaccaccccgttcgacatggtggtgcgcaaccacctcgaccggttccac
atcgtctcgaacgtcatcgaccgcgtgcccggcctggccacccgcgccgcctacgccaaa
caggccatccgcgacaagctggtggaccacacccgctacatcgccgaatacggacgcgac
atgccggaaatcgaagactggcgctggtcgtaa

DBGET integrated database retrieval system