KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_1625Help
Entry
GDI_1625          CDS       T00631                                 

Gene name
dfrA
Definition
dihydroflavonol-4-reductase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(1635960..1637051)
Genome map
AA seq 363 aa AA seqDB search
MVPHRFAANRPPHGGFPRDVRLLTYTGASDRIMTAPTLVTGATGFVGSAVARTLLQRGHS
LRLMARKGADLTNIRDLPAELVEGDLSAPATFADAVRGCRYVFHVAADYRLWVPDPAPMM
TANVEGTRRLMLAAQDAGVERIVYCSSVAALGLIGDGTVSDEDTPVHEHAVIGIYKRSKY
RAEQEVLRLVRERGLPAVIVNPSTPVGPRDIKPTPTGQMILDCAAGRMPAYVDTGVNIVH
VDDVAEGHVLALERGRAGEKYILGGQNFLLRDLFAMTADIAGVRPPRVSLPQSVIWPVAV
VSEWLSRGFGIAPRVTREMLAMSHKKMFFSSAKAERELGYAPRPARDAVADAVAWFRQNG
MLG
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggtgccgcatcgtttcgccgccaaccggccgccccatgggggtttcccccgggacgtc
cgcctgctgacatataccggagcatccgatcggatcatgactgcccccacgcttgttacc
ggcgcgaccggttttgtcggttcggccgttgcccgtacgcttctccagcgggggcattcg
ctgcgcctgatggcgcgcaagggggcggacctgaccaatatccgcgacctgccggcggaa
ctggtcgaaggcgacctgtccgcgcccgccaccttcgccgacgcggtgcgggggtgtcgc
tacgtcttccatgtcgccgccgactatcggctgtgggtgcccgaccccgcgcccatgatg
accgcgaatgtcgagggaacgcgccgcctgatgctggcggcgcaggacgcgggggtggaa
cggatcgtctattgctcgtcggtcgcggcgctggggctgatcggcgacggcaccgtgtcg
gacgaggacacgccggttcacgagcacgcggtgatcgggatctacaagcggtccaaatac
cgggcggagcaggaggtcctgcgcctggtccgcgaacgcggcctgccggcggtgatcgtc
aacccgtccacccccgtgggcccgcgcgacatcaagccgacgccgacgggccagatgatc
ctggattgcgcggcggggcgcatgccggcctatgtcgataccggggtgaacatcgtccat
gtcgacgacgtggccgagggccacgtcctggcgctggaacgcggccgggcgggtgagaaa
tacatcctgggcggccagaatttcctgctgcgcgacctgttcgccatgacggcggacatc
gcgggcgtgcggccgccgcgcgtcagcctgccgcaatcggtgatctggccggtggcggtg
gtgtcggaatggctgtcgcgcggcttcggcatcgccccgcgcgtcacgcgcgagatgctg
gccatgtcgcacaagaagatgttcttttcctcggccaaggccgaacgggagctgggctat
gccccgcgcccggcgcgcgacgcggtggcggatgccgtggcctggttccgccagaacggc
atgctgggctag

DBGET integrated database retrieval system