KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_1688Help
Entry
GDI_1688          CDS       T00631                                 

Gene name
cheB
Definition
chemotaxis response regulator protein-glutamate methylesterase o group 1 operon
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:gdi00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    GDI_1688 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    GDI_1688 (cheB)
Enzymes [BR:gdi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     GDI_1688 (cheB)
Two-component system [BR:gdi02022]
 CheA family
  CheA-CheYBV
   GDI_1688 (cheB)
Bacterial motility proteins [BR:gdi02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    GDI_1688 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1712379..1713416
Genome map
AA seq 345 aa AA seqDB search
MEKPIRVLVVDDSRTIRALIKRSFGQNPDIVVCGEAANPIEARDLIIQDQPDVITLDVEM
PGMNGLQFLEKIMRLRPIPVVMVSSLTARGADTAITALQMGAFDCFPKPSSVVGADAFAG
LARLVIQAARSHPVARLPRRDPASPPRQHADWGHSIGLIAIGASTGGVEAIEEVLSGFPA
QSPPIVICQHMPALFTASFANRLDQKIAALSIGEARDGEVLAPGVVRIAPGGDRHTVVER
RDGRYVTRLVKSPPVSGHCPSVDVLFGSVARQAGNDALGIILTGMGQDGAEGLLAMRHAG
AQTIAQDKASAVVYGMPRIAAEIGAASRIVPLCQISAAAMTVHTR
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggagaagccgatcagggttctcgttgttgacgactcgcggacaataagggcgcttatc
aagaggtccttcggccagaacccggatatcgtcgtttgtggcgaagcggcgaacccgatc
gaggcgcgggacctgatcatccaggatcagccggacgtcatcacgctcgatgtcgagatg
cccggcatgaacggtctccagttcctggagaagatcatgcgactgcgcccgattccggtc
gtgatggtatccagcctgaccgcgcggggtgccgacacggcgatcacggccctgcagatg
ggcgcgttcgattgtttcccgaaaccgtcctcggtcgtcggcgcggatgctttcgccggc
ctggcgcggcttgtcatccaggccgcgcgttcgcatcccgttgccaggcttccgcgtcgc
gacccggcgtccccgccgcgccagcatgcggactgggggcattcgatcgggctgatcgcg
atcggggcctcgaccggtggagtcgaggcgatcgaggaagtgctgtcaggctttcccgcc
cagagcccacccatcgtcatctgccagcatatgcccgcgcttttcacggccagcttcgcc
aacaggctggaccagaagatcgcggccctgtccataggtgaggcaagggatggcgaggtg
ctggcgcccggtgtcgtcaggatcgccccgggtggggacaggcacaccgtggtggaacgg
cgcgacggccggtacgtgacgcgcctggtgaaatcaccgccggtcagtggccactgcccc
tcggtggatgtcctgttcggctccgttgccaggcaggccggcaacgatgcccttggcatt
atcctgaccggcatgggccaggatggagccgagggcctccttgccatgcggcatgccggg
gctcagacgattgcgcaggacaaggcgtctgcggtcgtttatggaatgcctcggattgca
gccgagatcggggcggcttcccggattgtccctctttgccagatcagcgccgccgccatg
accgttcatacgcgttga

DBGET integrated database retrieval system