KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_1753Help
Entry
GDI_1753          CDS       T00631                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:gdi00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1777217..1778716
Genome map
AA seq 499 aa AA seqDB search
MNKKTTILAIDQGTTSTRSIIFDRDATPLATSRIEFAQHYPDHGWVEHDAEEIWRDALST
ARAAIEQGGGVDAIAALGITNQRETIVVWDRATGTPIHRAIVWQDRRTASMCARMRQDGC
EGLVRDRTGLLLDPYFSASKLAWMLDNVPGARASAEAGRLAFGTIDSFLLWRLTGGRVHA
TDVTNASRTLLFDIHRQVWDDDLLRLFGIPAALLPEVRGNSEIYGETDPALFGRPIPVAG
MAGDQQAALVGQACFAPGMAKATYGTGCFVLLNTGTAPVQSANRMLTTIGYRIGDRTTYA
LEGAIFVAGAAIKWLRDGLHLITHASQTDDMATRIPHSHGVYMVPGFVGLGAPHWDPEAR
GLICGLTLDATAAHIARAALESVAYQTYDLMAAMAQDGGGAVTTLRVDGGMAANDWFCRF
LSDVLQARVERPRHLETTATGAAFLAGLATGVWTDLDDVAARRARGSLFQPTMDLAQRGT
MLDGWHQAVRRTLTADASA
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagaagacgaccatcctggcgatcgatcagggcacgacgtccacccgcagcatc
atcttcgatcgcgacgcgacgccgctggcgacatcgcggatcgagttcgcgcagcattat
cccgaccatggctgggtcgagcatgacgcggaagagatctggcgcgatgcgctttcgacc
gcgcgcgcggcgatcgaacagggcggcggggtggatgcgatcgcggccctgggcatcacc
aaccagcgcgagaccatcgtggtctgggaccgcgcgaccggaacccccatccatcgcgcc
atcgtctggcaggaccgccgcacggcgtccatgtgcgcccgcatgcgccaggacgggtgc
gaggggctggtgcgcgaccggaccggcctgctgctggacccctatttttccgccagcaag
ctggcctggatgctggacaacgtccccggcgcgcgcgcgtccgccgaagccgggcgcctg
gccttcggcaccatcgacagcttcctgctgtggcgcctgaccggcgggcgggtccatgcc
accgatgtgacgaacgcgtcgcgcaccctgctgttcgacatccatcgccaggtctgggac
gacgacctgctgcggttgttcggcattccggcggcgctgctgcccgaggttcgggggaac
agcgaaatctacggcgaaaccgatcccgccctgttcggccggccgattccggtggcgggc
atggccggggaccagcaggcggcgctggtgggccaggcctgcttcgcccccggaatggcc
aaggcgacctatggcaccggctgcttcgtcctgctgaacaccggcacggccccggtgcag
tcggccaaccggatgctgaccacgatcggctaccggatcggcgaccgcacgacctatgcg
ctggaaggggcgatcttcgtcgcgggggccgcgatcaagtggctgcgcgacgggctgcac
ctgatcacccacgcgtcgcagaccgacgacatggcgacgcgtattccccacagtcacggc
gtctacatggtgccgggattcgtgggcctgggcgcgccgcattgggaccccgaggccagg
gggctgatctgcggcctgacgctggacgcgacggcggcgcatatcgcccgcgcggcgctg
gaatcggtcgcctaccagacatacgatctgatggcggcgatggcgcaggacggcggcggg
gcggtgaccaccctgcgtgtcgatggcggcatggcggccaatgactggttctgccggttc
ctgtccgacgtgctgcaggcccgggtggagcggccgcgccacctggaaaccacggcgacc
ggcgccgccttcctggccgggctggccacgggggtgtggacggacctggatgacgtggcc
gcccgccgggcgcgcggcagcctgttccagcccacgatggacctggcccagcgcggtacc
atgctggacggctggcaccaggcggtccggcgcaccctgaccgccgacgcttccgcgtag

DBGET integrated database retrieval system