KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_1760Help
Entry
GDI_1760          CDS       T00631                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:gdi01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:gdi00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:gdi00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:gdi00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:gdi00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:gdi00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1783826..1784794
Genome map
AA seq 322 aa AA seqDB search
MREIVAVDIGGTHARFAIAGVEGGRVTHLGEATTLKCAEHASLQLAWESFARQVGRTLPR
AAGIAVACPVQGDILKLTNNPWIIQPAQLAAKLDVDQHVLVNDFGAVGHAVAQVDAAHLQ
HLCGPDRPLPASGVTTIVGPGTGLGTAYVVRRDGRYLVCETEGGHVDFSPLDMLEDKILQ
RLRRRYRRVSTERVVSGPGLVNLYEAIAEIEGLPVRTRDDKELWTLALDGADHMAAAALE
RFCLALGAVAGDLALSQGGNSVVIAGGLGLRLAQHLPRSGFAERFVAKGRFESLMADMPV
KLITHPQPGLFGAAAAFAERFA
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagagagatcgtagccgtcgatatcggcgggactcatgcgcgtttcgccattgccggt
gtcgagggcggccgtgtcacccacctgggggaagccaccaccctgaaatgcgcggagcat
gccagcctgcaactggcgtgggagtccttcgcccgtcaggtcggccgcaccctgccgcgt
gcggcgggcatcgccgtcgcctgcccggtgcagggcgatatcctgaagctgacgaacaat
ccctggatcatccagccggcccaactggccgcgaagctggatgtggaccagcatgtgctg
gtcaatgatttcggcgcggtgggccacgccgtggcccaggtggacgcggcccatctgcag
cacctgtgcggcccggaccggccgctgcccgccagcggggtgacgaccatcgtcgggccg
ggaacggggctgggcaccgcctatgtcgtgcggcgggacggccgctatctggtgtgcgag
accgaaggcggccatgtcgatttctcgcccctcgacatgctggaggacaagatcctgcag
cgcctgcgccggcgatatcgccgcgtgtcgaccgagcgcgtcgtgtcgggcccggggctg
gtcaatctgtacgaggcgatcgccgaaatcgagggcctgccggtccgcacgcgcgacgac
aaggaattatggaccctggcgctggacggagccgaccatatggccgcggcggcgctggag
cgattctgcctggcgctgggggccgtcgccggtgacctggcgctgtcgcagggtggcaac
agcgtggtgatcgcgggcggcctgggcctgcggctggcccagcatctgccccggtccgga
ttcgccgagcgattcgtcgccaaggggcgattcgaatcgctgatggccgacatgccggtc
aagctgatcacccacccgcagcccggcctgttcggcgcggcggcggccttcgccgagcga
ttcgcctga

DBGET integrated database retrieval system