KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_1761Help
Entry
GDI_1761          CDS       T00631                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Brite
Enzymes [BR:gdi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     GDI_1761 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1785104..1785820
Genome map
AA seq 238 aa AA seqDB search
MPCGRESCEGSVMNQSALGEAVLDYDAARQRMVDAQIRPVAINDSRIIAAMRALPREDCV
PEALRPFAYADQSLEIGRGRVLTEPRIAGRMVQIAAPQAAQRALVVGAGTGYLAALLARL
ELQVTALESDAALSAIGKAFCAVEAPGVTWVDGPLQAGDPAHAPFDLIVIDGAVREVPHA
LPGQLAEHGRIVCVIWPQGGVASACIAEPTAQGLAVRRVFDVALPLLPELEPAPAFAF
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
ttgccgtgcggtcgggaaagttgtgaagggagcgtcatgaaccagtccgcgcttggagaa
gccgtcctcgattacgatgccgcgcggcaaaggatggtggatgcgcagatccgcccggtg
gcgatcaacgattcgcgaatcatcgcggcgatgcgtgccctgccgcgcgaggactgcgtc
cccgaggcgctgcgccccttcgcctatgccgaccagagcctggagatcggccgcggccgc
gtgctgacggaaccgcgcattgccgggcggatggtgcagatcgcggccccgcaggccgcg
cagcgcgccctggtggtgggggccgggacgggctacctggccgcgctgctggcccggctg
gaactgcaggtcacggccctggaatccgatgccgcgctcagcgcgatcggcaaggccttc
tgcgcggtcgaggcaccgggcgtcacctgggtggacggcccgctgcaggcgggcgacccc
gcgcatgcgccgttcgacctgatcgtgatcgacggggcggtgcgtgaggtcccgcatgcc
ctgccgggacaactggccgagcacgggcgcatcgtctgcgtcatctggccccaggggggc
gtcgcctccgcctgcatcgccgagcccaccgcgcaggggctggcggtccgccgggtcttc
gacgtcgccctgccgctgctgccggaactggagcccgcgcctgcctttgcgttctga

DBGET integrated database retrieval system