KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_1769Help
Entry
GDI_1769          CDS       T00631                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:gdi03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1796591..1797451
Genome map
AA seq 286 aa AA seqDB search
MPELPEVETVMRGMRLHLDGKTIARVAVRRADLRFPFPADLVARLEGATITGFARRAKYI
LIRLDTGDTLLLHLGMSGRVLLSLPGDAPVPDRHEHFFFETTDGTRCGLIDPRRFGAVDL
MPTAEERAHRLLARLGPEPLGNQFSQHWLQEVLARRRTSIKAALLDQTVVAGLGNIYVSE
ALFRAGIHPARLACTLDAAEDARLVQAIRAVLREAIAAGGSSLRDYVQPDGELGYFQHAW
RVYGRAGQGCPDCPGPPACHGVERLEQAGRSSFFCPLCQPPPGKVS
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgccggaactccctgaagtcgaaacagtgatgcgcgggatgcgattgcatctcgacggg
aagacgatcgcgcgggtcgcggtgcgtcgcgccgacctgcgtttcccctttcccgcggac
ctggtggcccggctggagggcgccacgatcaccggtttcgcccgacgggcgaaatatatc
ctgatccggctggatacgggcgataccctgctgctgcacctgggcatgtcggggcgggtc
ctgctgtcattgcccggcgacgcccccgtgcccgaccggcacgagcatttcttcttcgag
accacggacgggacgcggtgcggcctgatcgaccccaggcgcttcggcgcggtcgacctg
atgccgacggcggaggagcgagcacatcggctgctggcccgactcggtcccgaaccgctg
ggcaaccagttctcgcaacactggctgcaggaagtactggcccggcggcggacctccatc
aaggcggcgctgctggaccagacggtggtggcgggcctgggcaatatctatgtgtccgag
gcgctgttccgcgccggcatccatccggcacgcctggcctgcaccctggacgcggccgag
gacgcgcgcctggtccaggcgatccgcgccgtgctgcgcgaagcgatcgcagcgggcggg
tccagcctgcgcgactatgtccagccggatggggaactgggttatttccagcacgcgtgg
cgtgtctacggccgtgcggggcagggatgcccggattgtcccggtccccccgcatgccat
ggtgtggagcggctggaacaggccggacgctccagcttcttctgccccctgtgccagccc
ccgccgggcaaggtctcgtga

DBGET integrated database retrieval system