KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_1769Help
Entry
GDI_1769          CDS       T00631                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:gdi00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    GDI_1769 (mutM)
Enzymes [BR:gdi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     GDI_1769 (mutM)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     GDI_1769 (mutM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1796591..1797451
Genome map
AA seq 286 aa AA seqDB search
MPELPEVETVMRGMRLHLDGKTIARVAVRRADLRFPFPADLVARLEGATITGFARRAKYI
LIRLDTGDTLLLHLGMSGRVLLSLPGDAPVPDRHEHFFFETTDGTRCGLIDPRRFGAVDL
MPTAEERAHRLLARLGPEPLGNQFSQHWLQEVLARRRTSIKAALLDQTVVAGLGNIYVSE
ALFRAGIHPARLACTLDAAEDARLVQAIRAVLREAIAAGGSSLRDYVQPDGELGYFQHAW
RVYGRAGQGCPDCPGPPACHGVERLEQAGRSSFFCPLCQPPPGKVS
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgccggaactccctgaagtcgaaacagtgatgcgcgggatgcgattgcatctcgacggg
aagacgatcgcgcgggtcgcggtgcgtcgcgccgacctgcgtttcccctttcccgcggac
ctggtggcccggctggagggcgccacgatcaccggtttcgcccgacgggcgaaatatatc
ctgatccggctggatacgggcgataccctgctgctgcacctgggcatgtcggggcgggtc
ctgctgtcattgcccggcgacgcccccgtgcccgaccggcacgagcatttcttcttcgag
accacggacgggacgcggtgcggcctgatcgaccccaggcgcttcggcgcggtcgacctg
atgccgacggcggaggagcgagcacatcggctgctggcccgactcggtcccgaaccgctg
ggcaaccagttctcgcaacactggctgcaggaagtactggcccggcggcggacctccatc
aaggcggcgctgctggaccagacggtggtggcgggcctgggcaatatctatgtgtccgag
gcgctgttccgcgccggcatccatccggcacgcctggcctgcaccctggacgcggccgag
gacgcgcgcctggtccaggcgatccgcgccgtgctgcgcgaagcgatcgcagcgggcggg
tccagcctgcgcgactatgtccagccggatggggaactgggttatttccagcacgcgtgg
cgtgtctacggccgtgcggggcagggatgcccggattgtcccggtccccccgcatgccat
ggtgtggagcggctggaacaggccggacgctccagcttcttctgccccctgtgccagccc
ccgccgggcaaggtctcgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system