KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_1941Help
Entry
GDI_1941          CDS       T00631                                 

Gene name
pdhC
Definition
dihydrolipoamid acetyltransferase component of pyruvate dehydrogenase complex
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gdi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GDI_1941 (pdhC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GDI_1941 (pdhC)
   00020 Citrate cycle (TCA cycle)
    GDI_1941 (pdhC)
   00620 Pyruvate metabolism
    GDI_1941 (pdhC)
Enzymes [BR:gdi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     GDI_1941 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1975914..1977188
Genome map
AA seq 424 aa AA seqDB search
MSVNILMPALSPTMTEGKLSRWLKKEGDAIHSGDVIAEIETDKATMEVEAVDDGLLGRIL
VSEGTEGVKVNAPIAIVVAEGESVPDDAAPVAAAPAAAPVAAAPVSEAKAPAIAAAPAVP
QGAAPAPAQGTRVFASPLARRIAAQKGIDLSGVKGSGPNGRIVRRDVESATAAPVAAPVP
SPAPSAPAAAIEAPHTAVPNSTIRKVIARRLTEAKSTIPHFYVAMDVELDALLDLRAKLN
AASPAEGPGAFKLSVNDMLIKAVAVTLRRVPKVNASYTEDATILYDDVDVSVAVSIADGL
ITPIVRQADRKSLREISEDAKDLITRARAGKLKPQEFQGGSFSISNMGMYGVKEFSAIIN
PPQAAILAIAAAEKRAVVKDDAIRIATVMTVTLSVDHRVVDGALAAEWVSTFRSVVESPL
SLVV
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtgaatatcctgatgccggcgctgtcgccgacgatgaccgagggcaagctgtcc
cgctggctgaagaaggaaggcgacgcgatccattccggcgacgtgatcgccgagatcgag
accgacaaggcgacgatggaggtcgaggccgtggatgacggcttgctgggccgcatcctg
gtttccgaaggcaccgaaggggtgaaggtcaacgcgccgatcgccatcgtggtggcggaa
ggcgagagcgttcccgatgacgcagcccccgtggcggctgctccggcggcggctcccgtg
gcggcggccccggtttccgaggccaaggcaccggcgatcgcggccgccccggccgtgccc
cagggcgcggcgccggctccggcccagggcacgcgcgtcttcgcgtcgccgttggcgcgg
cgcatcgcggcgcagaaggggatcgacctgtccggcgtgaagggcagcggcccgaatggc
cggatcgtgcgtcgcgacgtcgaatccgcgacggcggcgcccgtggcggccccggtacca
tccccggcaccgtccgccccggccgcagcgatcgaggcgccgcataccgccgtgccgaac
tcgaccatccgcaaggtcatcgcccggcggctgaccgaggcgaagtcgaccatcccgcat
ttctacgtggcgatggatgtggaactggacgcgctgctggacctgcgggcgaagctgaac
gcggcctcgccggccgagggaccgggagcgttcaagctgtcggtcaatgacatgctgatc
aaggcggtggcggtaaccctgcgtcgggtgccgaaggtcaatgcatcctataccgaggac
gcgacgatcctgtacgacgatgtcgatgtctcggtcgccgtgtcgatcgccgatgggctg
atcacgccgatcgtgcgccaggccgaccgcaagtcgctgcgcgagatcagcgaggacgcg
aaggatctgatcacccgcgcccgcgccggcaagctgaagccgcaggaatttcagggcgga
tcgttctcgatctcgaacatgggcatgtatggggtgaaggaattctcggccatcatcaat
ccgccccaggccgccatcctggccatcgcggcggctgagaagcgcgccgtggtcaaggac
gacgcgatccggatcgccaccgtgatgacggtgacgctgtcggtcgatcatcgcgtcgtc
gacggcgccctggccgccgaatgggtttcgaccttccgctcggtggtcgaatcgccgctg
agcctggtggtctga

DBGET integrated database retrieval system