KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_2064Help
Entry
GDI_2064          CDS       T00631                                 

Gene name
ccp
Definition
cytochrome c551 peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Brite
Enzymes [BR:gdi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     GDI_2064 (ccp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(2108838..2110196)
Genome map
AA seq 452 aa AA seqDB search
MGYLTHFDHDTAPTLGTNSPTLADPVASAAFAAIRESRCDYCHARNTDLPFYFHVPVANQ
LMQRDVDQGLRHFRIEPVLAAFQSGAVPSEEQLARIEEVVRQNRMPPTLYLLLHWHAHLS
QAQRDALLTWIAAERRAHYATPGVAPRFAAEPVQPVPETLPVDAAKVALGQRLFFDKQLS
GDGTLNCASCHALDHGGVDGRVTALGIDNRHGPINVPTVYDAAFNQSQFWNGRAATLADQ
AAGPVMNPLEMGSHDWTGVADKLKQDPTYLTAFQGVFGSDEITRDRITDAIAEYEKTLIT
PDSRFDRYLKGDDQALNAQEKNGYALFKSVGCSGCHTGVSLGGQAFEAMGLEGDYFAARG
GTLTDADKGRYMVTHSDADMERFKVPNLRNIALTAPYFHDGSVKTLDQAVREMARYQTPD
HDLSDHDVADIVAFLQTLTGTYQGHQLAETTH
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
gtggggtatctgacccatttcgaccatgacaccgcgccgacattgggcacgaattctcca
acactggccgatccggtcgcctcggcggccttcgccgcgattcgcgaatcccggtgcgac
tactgccatgcccgcaataccgacctgccgttctatttccatgtgccggtggcgaaccag
ttgatgcagcgcgacgtggaccagggcctgcgtcatttccggatcgagcccgtgctggcc
gcgttccagagcggcgccgttccgtccgaggaacaactggcgcggatcgaggaagtggtg
cgccagaaccgcatgccgccgaccctgtacctgctgctgcactggcacgcccatctgtcg
caggcgcagcgtgacgcgctgctgacctggatcgcggcggaacggcgcgcgcattacgcg
accccgggggtcgccccacgcttcgcggccgaaccggtgcagccggtgcccgagacgctg
ccggtggatgcggccaaggtcgcgctgggccagcgcctgttcttcgacaagcaattgtcg
ggggacggcaccctcaattgcgccagttgccatgcgctggaccatggcggcgtggacggc
cgggtcacggcgctgggcatcgacaaccgccacggcccgatcaacgtgcccaccgtctat
gacgccgcgttcaatcagagccagttctggaacggccgcgccgcgaccctggccgaccag
gcggcgggaccggtgatgaacccgctggaaatgggatcgcacgactggaccggcgtggcc
gacaagctgaagcaggaccccacctacctcaccgcgttccagggcgtcttcggctcggac
gagatcaccagggaccggatcacggatgcgatcgcggaatatgaaaagaccctgatcacc
cccgacagccgcttcgaccgctacctgaagggcgacgaccaggccctgaacgcgcaggaa
aagaacggctacgcgctgttcaagagcgtgggatgctcgggctgccacaccggcgtctcg
ctgggcgggcaggcgttcgaggcgatgggcctggagggcgattacttcgccgcgcgcggc
ggcacgctgaccgatgccgacaagggacgctatatggtgacccattcggacgccgacatg
gaacgcttcaaggtgccgaacctgcgcaacatcgccctgaccgcgccgtatttccatgac
ggcagcgtcaagacgctggaccaggcagtgcgggaaatggcgcgctaccagacgcccgat
cacgacctgtcggaccacgacgtggccgatatcgtggccttcctccagaccctgaccggc
acctaccagggccaccaactggctgaaaccacgcactga

DBGET integrated database retrieval system