KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_2069Help
Entry
GDI_2069          CDS       T00631                                 

Definition
uroporphyrinogen III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gdi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GDI_2069
Enzymes [BR:gdi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     GDI_2069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(2114000..2114668)
Genome map
AA seq 222 aa AA seqDB search
MAAVERLGWQAHAMPALRIEPIMDAVLPLARTQAVLLTSGQAIAALAGRVRPDMPILAVG
AVTARRMRDAGFTDVTVAAGTAADLADLARDRLDPGAGSLLVPTAPTYGQDLAVALRRAG
FRVSRRCVYRVRPAGAPDAAVRTALAGGVIDAALFYSAETARQFLRHLPAGGHAALRNIR
AIAISKSTEAALSTATWRAIQVAARPDQAAILDRLGRRPAGE
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtcgaacggctgggctggcaggcccatgccatgcccgcgctgcggatcgaa
ccgatcatggatgccgtgttgccgctggcccgcacccaggccgtcctgctgaccagcggg
caggccatcgcggcgctggcgggccgcgtacggcccgacatgccgattctggcggtcggc
gcggtcacggcccgacggatgcgcgatgcgggattcaccgacgtcacggtggcggcggga
acggcggccgacctggcggacctcgcccgcgaccggctggacccgggggcggggtccctg
ctggtgccgacggcgcccacctatggacaggatctggccgtggcgctgcggcgggccggg
ttccgcgtcagccggcgctgcgtctatcgggtgcggcccgcgggggcgcccgacgcggcg
gttcgcacggccctggccgggggcgtcatcgacgcggccctgttctattcggccgagacg
gcacgccagttcctgcgtcacctgccggcgggcgggcacgccgccctgcggaacatccgg
gcgatcgcgatttcaaagtcaaccgaggcggcgctgtccacggcgacctggcgtgcgatc
caggtcgcggcacgacccgaccaggcggcgatcctggaccggctggggcggcgaccggcc
ggggaatga

DBGET integrated database retrieval system