KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_2069Help
Entry
GDI_2069          CDS       T00631                                 

Definition
uroporphyrinogen III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:gdi00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(2114000..2114668)
Genome map
AA seq 222 aa AA seqDB search
MAAVERLGWQAHAMPALRIEPIMDAVLPLARTQAVLLTSGQAIAALAGRVRPDMPILAVG
AVTARRMRDAGFTDVTVAAGTAADLADLARDRLDPGAGSLLVPTAPTYGQDLAVALRRAG
FRVSRRCVYRVRPAGAPDAAVRTALAGGVIDAALFYSAETARQFLRHLPAGGHAALRNIR
AIAISKSTEAALSTATWRAIQVAARPDQAAILDRLGRRPAGE
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtcgaacggctgggctggcaggcccatgccatgcccgcgctgcggatcgaa
ccgatcatggatgccgtgttgccgctggcccgcacccaggccgtcctgctgaccagcggg
caggccatcgcggcgctggcgggccgcgtacggcccgacatgccgattctggcggtcggc
gcggtcacggcccgacggatgcgcgatgcgggattcaccgacgtcacggtggcggcggga
acggcggccgacctggcggacctcgcccgcgaccggctggacccgggggcggggtccctg
ctggtgccgacggcgcccacctatggacaggatctggccgtggcgctgcggcgggccggg
ttccgcgtcagccggcgctgcgtctatcgggtgcggcccgcgggggcgcccgacgcggcg
gttcgcacggccctggccgggggcgtcatcgacgcggccctgttctattcggccgagacg
gcacgccagttcctgcgtcacctgccggcgggcgggcacgccgccctgcggaacatccgg
gcgatcgcgatttcaaagtcaaccgaggcggcgctgtccacggcgacctggcgtgcgatc
caggtcgcggcacgacccgaccaggcggcgatcctggaccggctggggcggcgaccggcc
ggggaatga

DBGET integrated database retrieval system