KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_2077Help
Entry
GDI_2077          CDS       T00631                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:gdi00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    GDI_2077
  Metabolism of other amino acids
   00480 Glutathione metabolism
    GDI_2077
Enzymes [BR:gdi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     GDI_2077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2120792..2121277
Genome map
AA seq 161 aa AA seqDB search
MTTAYDFTLPSLDGGTIDLGALRGKPILIVNTASKCGFTPQFEGLQALWSFYRGNGLTII
GVPSNDFGNQEPGTSTEIATFCARNYSVTFPMAARSHVRGADTLPLFRWIAQQGGLMARP
RWNFYKYLIGRDGRLANWFVSLTSPESHRMRVAIERAILDT
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgcgtacgactttacccttccgtcgctggatggcggtacgatcgaccttggc
gcgctgcgcggcaagccgatcctgatcgtgaacaccgcgtcgaaatgcggcttcacgccg
caattcgaagggctgcaggcgctgtggtcgttctatcgcggcaacgggctgacgatcatc
ggcgtgccgtccaacgatttcggcaaccaggagcccggcacctcgaccgagatcgcgacc
ttctgcgcccgcaattacagcgtcaccttccccatggccgcgcgcagccatgtccggggc
gccgacacgctgccgctgttccgctggatcgcgcaacagggcggcctcatggcccgcccg
cgctggaacttctacaaatacctgatcggccgcgacggccgcctggcaaactggttcgtc
agcctgacatcgcccgaatcacaccgcatgcgcgtggctatcgagcgcgcgatcctggac
acctga

  All links  
No link information was found.   
DBGET integrated database retrieval system