KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_2077Help
Entry
GDI_2077          CDS       T00631                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:gdi00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:gdi00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2120792..2121277
Genome map
AA seq 161 aa AA seqDB search
MTTAYDFTLPSLDGGTIDLGALRGKPILIVNTASKCGFTPQFEGLQALWSFYRGNGLTII
GVPSNDFGNQEPGTSTEIATFCARNYSVTFPMAARSHVRGADTLPLFRWIAQQGGLMARP
RWNFYKYLIGRDGRLANWFVSLTSPESHRMRVAIERAILDT
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgcgtacgactttacccttccgtcgctggatggcggtacgatcgaccttggc
gcgctgcgcggcaagccgatcctgatcgtgaacaccgcgtcgaaatgcggcttcacgccg
caattcgaagggctgcaggcgctgtggtcgttctatcgcggcaacgggctgacgatcatc
ggcgtgccgtccaacgatttcggcaaccaggagcccggcacctcgaccgagatcgcgacc
ttctgcgcccgcaattacagcgtcaccttccccatggccgcgcgcagccatgtccggggc
gccgacacgctgccgctgttccgctggatcgcgcaacagggcggcctcatggcccgcccg
cgctggaacttctacaaatacctgatcggccgcgacggccgcctggcaaactggttcgtc
agcctgacatcgcccgaatcacaccgcatgcgcgtggctatcgagcgcgcgatcctggac
acctga

DBGET integrated database retrieval system