KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_2088Help
Entry
GDI_2088          CDS       T00631                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:gdi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GDI_2088 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GDI_2088 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    GDI_2088 (thrC)
Enzymes [BR:gdi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     GDI_2088 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2137693..2139090
Genome map
AA seq 465 aa AA seqDB search
MRYLSTRGQAPVRDFSSVLLAGLAEDGGLYLPETWPVLTADDWRALRGLPYPDLAARIIA
PFTAGCIAPDVLQRLCRESYAGFDHAAIVPLTQVEDGLFVQELFHGPTLAFKDMAMQLLG
RLFDHVLAERDAHVTIVGATSGDTGSAAIEACRGRERVKIVILHPEGRTSDVQRRQMTTV
LEPNVTNLAVQGTFDDCQDLVKAMFADAPFRQDMHLSAVNSINWARIAAQIPYYVYAALA
LGAPDREVSFAVPTGNFGNILAAWAARRMGLPVRALCVGSNRNDILTRFLRDNDMSVQGV
VPSLSPSMDIQVSSNFERLLFELLNRDAAACARIVTEFRQTGHMAVPDPVWRQASGLFHA
LALDDQDTKTEIRNLHAASQYLADPHSAIGIAAGRMFREPGIPMVAMATAHPAKFPDAME
QATGIRPALPPALADLFDRPERYEVVAARLDVVEDRVRAAVLKNA
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatctttccacccggggacaggcccccgtccgtgacttttcctcggtcctgctg
gccggcctggccgaggacggcgggctgtacctgccggaaacctggcccgtcctgaccgcc
gacgactggcgggcactgcgcggcctgccctatcccgacctggccgcgcggatcatcgcg
ccctttaccgcgggctgcatcgcgccggatgtgctgcagcggctctgccgcgaatcatat
gccgggttcgaccacgccgccatcgttccgctgacgcaggtcgaggacgggctgttcgtc
caggaactgttccacgggccgacgttggccttcaaggacatggcgatgcagttgctgggg
cggctgttcgaccatgtgctggccgagcgcgacgcgcatgtgaccatcgtgggcgccacg
tcgggcgataccggatcggcggcgatcgaggcctgccgcgggcgcgaacgggtgaagatc
gtcatcctgcaccccgagggccggacatcggacgtgcagcggcggcagatgaccacggtg
ctggaaccgaacgtgaccaacctggcggtgcagggcacgttcgacgattgccaggacctg
gtgaaggcgatgttcgccgacgcccccttccggcaggacatgcacctgtcggcggtcaat
tccatcaactgggcccgcatcgcggcgcagatcccctattacgtctatgccgccctggcg
ctgggcgcgccggaccgcgaggtctcgttcgccgtgccgaccggcaatttcggcaacatc
ctggcggcgtgggcggcacggcgcatgggcctgcccgtgcgcgcgctgtgcgtggggtcc
aaccgcaacgacatcctgacccgtttcctgcgcgacaacgacatgagcgtgcagggcgtg
gtgcccagcctgtcgccgtcgatggacatccaggtctcctcgaatttcgagcggctgctg
ttcgaactgctgaaccgcgatgcggcggcatgcgcgcgcatcgtcaccgaattccgccag
accggccacatggcggtgcccgacccggtgtggcggcaggcatcgggcctgtttcacgcc
ctggcccttgacgatcaggacacgaagaccgaaatccgtaacctgcatgccgccagccag
tatctggccgacccgcacagcgccatcgggatcgccgccgggcggatgttccgcgaacct
ggcattccgatggtggcgatggccaccgcccatccggccaagttccccgacgccatggaa
caggcgaccggcatccgcccggccctgccgccggcgcttgcggatctattcgaccggccg
gaacgttacgaagtcgtggccgcgcggctggacgtggtcgaggaccgggttcgggcggcg
gtgctgaagaacgcctga

DBGET integrated database retrieval system