KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_2102Help
Entry
GDI_2102          CDS       T00631                                 

Gene name
pmtA
Definition
phosphatidylethanolamine N-methyltransferase
Orthology
K00570  
phosphatidylethanolamine/phosphatidyl-N-methylethanolamine N-methyltransferase [EC:2.1.1.17 2.1.1.71]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, PE => PC
Brite
KEGG Orthology (KO) [BR:gdi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    GDI_2102 (pmtA)
Enzymes [BR:gdi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.17  phosphatidylethanolamine N-methyltransferase
     GDI_2102 (pmtA)
    2.1.1.71  phosphatidyl-N-methylethanolamine N-methyltransferase
     GDI_2102 (pmtA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(2150945..2151580)
Genome map
AA seq 211 aa AA seqDB search
MKAAYRRWAGVYDALFGGVSAFGRKRAVAAVNGLPGSAVLEVGVGTGLALPHYRSDKRIT
GIDLSGDMLDRARQRVARMNLRNVDALLEMDAEETRFADGSFDIAVAMFVASVVPNPRRL
LCELKRVVRPGGHILFVNHFLATGGVRLAVERGMARASHSLGWHPDFAIESLLPPADLAQ
ATIQSVPPAGLFTLVTLPRDGAAPSVETMAG
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagccgcctatcgccgctgggcgggcgtgtatgacgccctgttcggcggggtctcg
gccttcgggcgcaagcgcgcggtcgcggcggtcaacggcctgcccggctcggcggtgctg
gaagtgggggtcggcaccggcctggcgctgccccattaccgatccgacaagcgcatcacc
ggcatcgacctgtcgggggacatgctggaccgggcgcgtcagcgcgtggcgcggatgaac
ctgcgcaatgtcgacgcgctgctggaaatggatgccgaggagacgcgcttcgccgatggc
tcgttcgacatcgcggtcgcgatgttcgtggcctcggtcgtgcctaatccgcgccggctg
ctgtgcgagctgaagcgcgtggtgcggccgggtggccacatcctgttcgtcaatcatttc
ctggccacgggcggcgtgcggctggcggtggaacgcggcatggcgcgggcctcgcactcg
ctgggctggcatcccgatttcgccatcgaatccctcctgccgccggccgacctggcgcag
gcgacgatccagtccgtgccccccgccgggctgttcacgctggtgacgctgccgcgtgac
ggcgcggcgccttcggtcgaaaccatggccggctga

DBGET integrated database retrieval system