KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_2158Help
Entry
GDI_2158          CDS       T00631                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:gdi00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(2210742..2211350)
Genome map
AA seq 202 aa AA seqDB search
MVWANGGGVRFFARTETGTGTRTVTVASSHGNAILKGMILIAIGANLPRAEGSTPLETCR
WAVEHIASIPGVRVVAVSAWYESAPIPPSGQPPYVNGVVAATGELDPAVLLAALQGIEAR
AGRRRTVANAARPLDLDIIAMGDLVRDAPDPILPHPRADARAFVLLPLRDVAPGWRDPRS
GRTVDALVADLPDQQIRRLEAD
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
ttggtatgggcgaatgggggcggggtccgctttttcgcccgaaccgaaacaggaaccgga
acaaggaccgttacggttgcatcttcgcacgggaacgccatcctgaagggcatgatcctg
atcgcaataggcgccaacctgccgcgcgccgaggggagtaccccgctggagacctgccgc
tgggcggtggagcacatcgcttccatcccgggggtccgggtcgtggcggtgtcggcctgg
tacgaaagcgcaccgattcccccctcgggccagccgccctatgtcaacggcgtcgtcgcc
gcgacgggcgagctggacccggccgtcctgctggcggcgctgcagggaatcgaagcccgg
gccggacggcgccggacggtggccaacgccgcccggccgctggacctggacatcatcgcg
atgggtgacctggtgcgcgacgccccggacccgatcctgccgcacccccgggccgacgca
cgggccttcgtcctgctgccgctgcgcgacgtggcccccggatggcgcgaccccaggtcc
ggccggacggtcgatgcgctggtcgcggacctgcccgaccagcagatccgccggctggag
gcggactga

DBGET integrated database retrieval system