KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_2449Help
Entry
GDI_2449          CDS       T00631                                 

Gene name
aceA
Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gdi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GDI_2449 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    GDI_2449 (aceA)
Enzymes [BR:gdi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     GDI_2449 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2539124..2540464
Genome map
AA seq 446 aa AA seqDB search
MEQTIEKGDPSMSIDTIAAFMADPERFAGIKRDYDARDVATLSGSFRIRHTLAEMGAARL
WHLLKTEPYINALGALTGNQAMQQVKAGLKAIYLSGWQVAADANVAGEMYPDQSLYPVNS
VPTVVRRINNALRRCDEIATQEGDRGQYWMAPIVADAEAGFGGPLNVFELMRALIAAGAA
GVHFEDQLASEKKCGHLGGKVLIPIAQHIRSLNAARLAADVEGVPTVLICRTDSHAAQLL
TSDIDERDHPFLTGERTREGFFRIREGLGVEYAIARSLAYAPYCDLLWWETSEPNLEEAR
QFAEAIHKQFPGKMLAYNCSPSFNWKKKLSARDIADFQRRIGAMGYKFQFVTLAGFHSLN
YSMFKLAHGYAERGMAAYSELQEAEFSAEVDGYTATRHQREVGTGWFDAVATVAGGGHTS
TAAMAGSTETEQFHADLSFDRNKTPV
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggaacagacgatcgaaaagggagatccgtcaatgtccatcgacaccattgccgccttc
atggccgaccccgagcgcttcgcgggcatcaagcgcgattatgacgcgcgcgacgtggcg
acgctctccggctcgttccgcatccgccacaccctggctgaaatgggtgccgcgcgcctg
tggcacctgctgaagaccgaaccctacatcaacgcgctgggcgcgctgacgggcaaccag
gcgatgcagcaggtcaaggcggggctgaaggccatctacctgtccggctggcaggtcgcg
gccgacgccaacgtggcgggcgagatgtatcccgaccagtcgctgtaccccgtgaattcg
gtgcccaccgtggtgcggcgcatcaacaacgccctgcgccgctgtgacgagatcgcgacg
caggagggcgatcgcggccagtactggatggcccccatcgtcgcggatgccgaggccggg
ttcggcggcccgctgaacgtcttcgagctgatgcgcgccctgatcgcggccggcgcggcg
ggcgtgcatttcgaggaccagttggcctcggaaaagaaatgcggccatctgggcggcaag
gtgctgatcccgatcgcgcagcatatccgctcgctgaacgcggcgcggctggcggcggat
gtcgagggggtgcccacggtcctgatctgccgcaccgacagccacgcggcgcagctcctg
acctcggacatcgacgagcgcgaccatccgttcctgaccggcgagcgcacgcgggaaggc
ttcttccgcatccgcgaggggctgggcgtcgaatacgccatcgcccgttcgctggcctat
gcgccctattgcgacctgctgtggtgggagacgtccgagccgaacctggaggaagcccgg
cagttcgccgaggccatccacaagcagttccccggcaagatgctggcctataactgctcg
ccgtccttcaactggaagaagaagctgtcggcgcgcgacatcgcggacttccagcgccgg
atcggggcgatgggctacaagttccagttcgtcaccctggcgggcttccacagcctgaac
tattcgatgttcaagctggcgcatggctacgcggaacgcggcatggccgcctattccgag
ttgcaggaagccgagttcagcgccgaggtcgacggctacaccgccacccgccaccagcgc
gaggtcgggaccggctggttcgacgcggtcgcgaccgtggccggcggcggccatacctcg
accgccgcgatggccggttcgaccgagaccgagcagttccatgccgacctgtccttcgac
cggaacaagacgccggtctga

DBGET integrated database retrieval system