KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_2450Help
Entry
GDI_2450          CDS       T00631                                 

Gene name
glcB
Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:gdi01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:gdi00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:gdi00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2540585..2542798
Genome map
AA seq 737 aa AA seqDB search
MSRRTIGQLRIHHALDAFVTHEVLPGTGVSADRFWMGLSDIVTHFTPKILNALARRRLLQ
QAVDHLLTAPGFDPGDVGAQIDLLRTVGYLEREPESVSIATRDVDAEIARIAGPQLVVPV
TNARYALNAANARWGSLYDAFYGTDAEPYDMQGVPTAGYDTQRGERVIRRVRLLLDEIMP
LTRGSHADVARYRVEDGRLTAALDDGAPPAGLRRPAQFAGFQGPPDAPRVVLLRNHGLHL
ELRFDPTSPIGSRDRAGISDVIAESAISTIMDCEDSVSAVDVEDKIQVYRNWLGLMQGTL
TASFRKGGRLLERRLAPDRHYTAPDGTPLVLPGRSLMLIRNVGHHMFTDAIVDTGGHPVP
EGVLDAAVTAVIALHDLRGTSRTTNSRTGSIYIVKPKMHGPEEVALSDALFARVERVLGL
GPNTIKMGIMDEERRTSANLAACIQAARERVVFINTGFLDRTGDEIHYCMQAGPVVRKAD
MRAEPWMAAYEQRNVAIGLACGLKDHAQIGKGMWAMPDRMADMMTQKIAHPRAGANTGWV
PSPTAATLHALHFHFVDVATVQARMENVPPAAIKGLMTLPLADPAAWSAAERRAELDNNL
QGILGYVVRWVDMGIGCSKVPDLDDVGLMEDRATLRISSQHVANWLHHGVVSQDEVRASM
IRMAAIVDGQNRDEPGYRPLADNAGGPAFRAASDLVFKGVTQPNGYTESTLHRWRRVAKD
GAAAANRTVPELDRAVP
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtcgcacgatcggccagcttcgcatccatcatgccctcgatgccttcgtcacg
cacgaagtcctgccgggaaccggcgtttccgccgaccggttctggatgggcctgtcggac
atcgtcacccatttcacgccgaagatcctgaacgccctggcgcgccgccgcctgttgcag
caggccgtggaccatctgctgaccgcacccggattcgatcccggcgatgtcggcgcgcag
atcgacctgctgcgcaccgtcggctatctggagcgcgagccggagagcgtgtcgatcgcc
acccgtgacgtcgatgccgaaatcgcgcgcatcgccgggccccagcttgtggttcccgtc
accaacgcccgctatgcgctgaatgccgccaacgcccgctggggcagcctgtatgacgcg
ttctacggcaccgacgccgagccgtacgacatgcaaggcgttcccaccgccggctatgac
acgcagcgcggcgagcgggtgatccggcgggtacggctgctgctggacgaaatcatgccg
ctgacgcgcggcagccacgccgacgtcgcgcgctatcgggtcgaggacggccggttgacg
gcggcgctcgacgacggcgcgccgccggccggcctgcgccgtccggcacagttcgccgga
ttccagggaccgccggacgcgccccgggtggtcctgctgcgcaatcacggcctgcatctg
gaactgcgcttcgacccgacatcgccgatcggcagccgggaccgcgccgggatatccgac
gtgatcgcggaatccgcgatcagcaccatcatggattgcgaggacagcgtttcggcggtc
gatgtcgaggacaagatccaggtctatcgcaactggctgggcctgatgcagggcaccctg
accgcgtcgttccgcaagggcggccgcctgctggaacggcgcctggcccccgaccggcac
tacaccgcgcccgacggcacgccgctggtgctgccggggcgcagcctgatgctgatccgc
aatgtcggccaccacatgttcaccgatgcgatcgtggacactggcggccacccggtgccc
gagggcgtgctggacgccgccgtgaccgccgtcatcgccctgcacgacctgcgcggaacg
tcgcgcaccaccaacagccggacgggatcgatctatatcgtcaagcccaagatgcacggg
ccggaagaggtcgccttgtccgacgccctgttcgcgcgcgtcgaacgggtgctgggcctg
gggccgaacaccatcaagatgggcatcatggacgaggaacggcggaccagcgccaacctg
gccgcctgcatccaggccgcgcgcgagcgggtggtgttcatcaataccggcttcctggac
cgcacgggggacgagatccattactgcatgcaggccggccccgtagtgcgcaaggccgac
atgcgcgccgagccgtggatggcggcatacgaacagcgcaacgtcgcgatcggcctggcc
tgcgggctgaaggaccatgcccagatcggcaagggcatgtgggcgatgccggaccgcatg
gccgacatgatgacgcagaagatcgcccacccccgcgcgggcgccaatacgggctgggtg
ccctcgcccaccgcggcgacgctgcatgcgctgcattttcacttcgtcgacgtggcgacg
gtgcaggcgcggatggaaaacgtgccgccggccgccatcaaggggctgatgaccctgccg
ctggccgatccggcggcgtggtcggcggcggagcgccgggccgaactggacaacaacctg
cagggcatcctgggttatgtcgtccggtgggtggatatgggcatcggctgttccaaggtg
ccggacctggacgatgtcggcctgatggaggaccgcgcgacgctgcgcatttcctcgcag
cacgtcgcgaactggctgcatcatggcgtggtgtcgcaagacgaggtccgggcgtccatg
atccgcatggccgccatcgtggacgggcagaatcgcgacgagcccggctatcgcccgctg
gccgacaacgcaggcggcccggccttccgcgccgcgtcggacctggtgttcaagggcgtg
acccagcccaacggctataccgagtccacgctgcatcgctggcgccgggtggccaaggac
ggcgccgccgcggcgaaccggacggtgccggaactggaccgggccgttccgtaa

DBGET integrated database retrieval system