KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_2473Help
Entry
GDI_2473          CDS       T00631                                 

Gene name
adh
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gdi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    GDI_2473 (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GDI_2473 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    GDI_2473 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    GDI_2473 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GDI_2473 (adh)
   00626 Naphthalene degradation
    GDI_2473 (adh)
Enzymes [BR:gdi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     GDI_2473 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(2564277..2565341)
Genome map
AA seq 354 aa AA seqDB search
MRSADTILGGTSMTGKMKAAVVREFGKPLTIEELDIPSIRPDQILVKMDACGVCHTDLHA
ARGDWPVKPNPPFIPGHEGVGHVVSVGSAVKWVKLGDVVGVPWLYSACGHCEHCLGGWET
LCASQDDTGYTVNGCFAEYVVADPSYVAHLPKTIDPLQVAPVLCAGLTVYKGLKMTDTKP
GDWVAVSGVGGLGQMAVQYGVAMGMNVIAVDIDDEKLATAKALGAALTVNARATDPAPFI
QSQVGGAHGALVTAVSRSAFSQAMGFARRGGTIVLNGLPPGEFPISIFDMVMAGTTVRGS
IVGTRLDMIEAVSFFADGKVKTVIEPDRLENINQIFTDLEEGKIQGRKVLDFRQ
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgcgatctgcggatacaatccttgggggaacgagcatgactggaaagatgaaggccgct
gtcgttcgtgagttcggcaagccgctgacgatcgaagagctggatattccctcgatccgg
ccggaccagatcctggtcaagatggacgcgtgcggcgtctgccacaccgacctgcacgcc
gcccggggggactggcccgtgaagccgaatccgcccttcatcccggggcacgagggcgtg
ggccacgtcgtgtccgtgggcagcgcggtcaaatgggtcaagctgggcgatgtcgtcggc
gtgccgtggctgtattcggcctgcggccattgcgagcactgcctgggcgggtgggaaacg
ctgtgcgccagccaggacgataccggctacaccgtcaatggctgcttcgccgaatatgtg
gtggccgatcccagttacgtcgcccacctgccgaagacgatcgacccgctgcaggtggcg
cccgtgctctgtgccggcctgacggtctacaagggcctgaagatgaccgacaccaagccg
ggtgactgggtcgcggtgtcgggtgtcggcgggctgggccagatggcggtgcaatacggc
gtcgccatggggatgaacgtcatcgccgtcgatatcgacgacgaaaagctggccacggca
aaggccctgggcgcggcgctgacggtgaacgcgcgcgccaccgatcccgcccccttcatc
cagtcgcaggtcggcggcgcccatggcgcgctggtcacggccgtgtcgcgcagcgcgttc
tcgcaggcgatgggctttgcccgccggggcggcacgatcgtgctgaacgggctgccgccg
ggggaattcccgatttccatcttcgacatggtcatggccgggaccacggtgcgcggatcg
atcgtcggcacgcggctggacatgatcgaggcggtgtccttcttcgccgacggcaaggtc
aagacggtgatcgagcccgaccggctggaaaacatcaaccagatcttcaccgacctggaa
gaaggcaagatccagggacgcaaggtgctggatttccgccagtaa

DBGET integrated database retrieval system