KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_2476Help
Entry
GDI_2476          CDS       T00631                                 

Gene name
ccp
Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2567915..2569270
Genome map
AA seq 451 aa AA seqDB search
MPRRSDSGRVWFILLLPVLWLCSPGDRPARAAGGPAPAACQPLSDGRNPCPVALRRPPAA
PLSAMALAGRDIFHDPALSGSGRLSCASCHDRARHYGPAGAAMVARGGVDLSRDGLRAVP
TLAYLERRPAFSIGPDNAESEAPPPPVATGLPHAAKTAQNNAATAANMVPQGGLFWDGRA
DTLQQQATGPLFDPREMASSRAVVLARLARAPYTPTLYRLGGPAVARSPDLLLAEALFAV
ARYQIEDPAFHPYASPFDDWLEGKTRLSPAQRRGYLLFNDPAKGNCAACHPDRPGADGRP
PLFTDHQFEALGAPRNRALAANRDPSFHDLGLCGPPRADMAGQSAMCGLFATPTLRNVAT
RHTFFHNGVFRTLDDVLAFYTFRDVDPGRIYPVGPDGQVRKFDDLPDRYQTNIDVADAPF
DRHPGDAPPLTPDERRDIVAFLDMLTDRPAR
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
gtgccgcgccgatcggacagcggccgggtatggttcatcctgctgctgccggtcctgtgg
ctgtgttcgccgggggatcggccggcccgtgcggcgggcggtccggcgcccgcggcctgc
cagcccctgtcggacgggcgcaacccctgccccgtcgccctgcgtcgcccgcccgccgcc
ccgctttcggcgatggccctggcagggcgcgacattttccatgatccggccctgtcgggg
tcgggacggctatcctgcgcgtcctgccacgaccgggcgcgccattacgggccggcgggt
gccgccatggtggcgcgcggtggggtcgacctgtcgcgggacgggctgcgcgccgtcccg
accctggcctatctggagcgccgccccgccttcagcatcggccccgacaatgccgaaagc
gaagccccgccgccgcccgtcgcgaccggcctcccccacgccgccaagaccgcgcagaac
aatgcggcgaccgctgccaacatggtcccgcagggcggcctgttttgggacggccgtgcc
gacacgctgcaacagcaggcgacaggcccgctgttcgacccccgggaaatggcgtccagc
cgcgccgtcgtcctggcccggctggcgcgggccccctacacccctaccctctatcgcctg
ggcggcccggccgtcgcgcggtcgccggacctgctgttggccgaggccctgttcgccgtg
gcgcgctaccagatcgaagaccccgccttccatccctacgccagccccttcgacgactgg
ctggagggaaagacgcgcctgtcccccgcccagcgccggggctatctgctgttcaacgac
ccggcgaagggcaattgcgcggcatgccaccccgaccggccgggggccgacggcaggccg
ccgctgttcaccgaccatcagttcgaggccctgggcgccccccggaaccgggcactggcc
gccaaccgcgatccgtccttccacgatctggggctgtgcgggccgccgcgcgccgacatg
gcgggccaaagtgcgatgtgcggcctgttcgcgacccccacgctacgcaatgtcgcgacg
cgccacacctttttccataacggggtgttccgcaccttggacgacgtcctggccttctac
accttccgcgacgtcgatcccggacgcatctatcccgtggggccggatgggcaggtgcgg
aaattcgacgatctgcccgatcgctaccagaccaatatcgacgtggccgatgccccgttc
gaccggcaccccggcgacgcgccgcccctgaccccggacgagcggcgggacatcgtcgcc
ttcctggacatgctgaccgatcgccccgcccgctga

DBGET integrated database retrieval system