KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_2537Help
Entry
GDI_2537          CDS       T00631                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gdi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GDI_2537
Enzymes [BR:gdi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     GDI_2537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(2634235..2635260)
Genome map
AA seq 341 aa AA seqDB search
MMGTIMRIIQLPMRSTALALLLLAGAMPARAQDYKGVNLAGAAYSSNKIPGRYGYDYLFP
KPGEVTYFHDRGMNIFRLSVLWERLQPAPGVALDSGYMGRINGFVDQVHAVGGKVILDIH
DYGRYRGTLIGDGQVTAADFRDLWTRLGTAFRDRPDVWFGLMNEPQQKSAEAWRDIEQQA
ILGIRAAGARNPILVSGVGWDAAHGFATVNAPALATLKDPDHSLVFEVHEYFDPDSSGRS
PDCIPTDQAVARLASFTAWLHQTGNKGFLGEFGVGRSAACLDVLDKVASYLAANQAVWLG
WTYWAAGPLWGEYMYTLEPTKTGQDRPQMLVLDRYLTHRGR
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgatgggaacgattatgcgcattatacaattgcccatgcgatcgaccgccctggcgctg
ctgctgctcgcgggggcgatgccggcccgggcccaggactacaagggtgtgaacctggcc
ggggcggcctattcgtcgaacaagatcccgggtcgctacggctacgactatctgtttccc
aagccgggcgaggtcacgtacttccatgaccgggggatgaatatctttcgcctgtccgtt
ctgtgggaacggctgcagcccgcgccgggggtggcgctggattccggttatatgggccgc
atcaacgggttcgtggaccaggtccacgcggtgggcggcaaggtcatcctcgatatccac
gattatggccgctatcgcggcacgctgatcggcgacggccaggtgaccgccgccgatttt
cgcgacctgtggacccgcctggggaccgcgttccgcgaccggccggatgtctggttcggc
ctgatgaacgaaccgcagcagaaatcggccgaggcgtggcgcgatatcgaacagcaggcg
atcctgggcattcgcgcggcgggggcccggaacccgatcctggtatcgggcgttggctgg
gacgccgcccatggtttcgcaaccgtaaatgctccggccctggccacgttgaaggacccc
gaccattccctggtgttcgaagtccatgaatatttcgatcccgacagttcgggccgcagc
ccggactgcatcccgaccgatcaggcggtcgcgcggctggcctccttcaccgcatggctg
caccagacgggaaacaagggcttcctgggcgaattcggcgtcggccgcagcgcggcctgc
ctggatgtcctggacaaggtcgcatcctatctggcggccaaccaggcggtctggctcggc
tggacctactgggccgccgggccgctatggggcgaatacatgtatacgctggaaccgacc
aagaccggacaggaccggccgcagatgctcgtcctggaccgttacctgacccaccggggg
agataa

  All links  
No link information was found.   
DBGET integrated database retrieval system