KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_2657Help
Entry
GDI_2657          CDS       T00631                                 

Gene name
fucI
Definition
L-fucose isomerase
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:gdi00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(2749143..2750915)
Genome map
AA seq 590 aa AA seqDB search
MNRSFPKIGIRPIIDGRRGGIRESLEDVTMAMAHRTAAFLTSELRHAGGEAVECVIADTC
IAGYAEAAACEEKFASAHVGLSISVTPCWCYGAETIDMVPERQKAIWGFNGTERPGAVYL
AAALAAHNQKGLPAFSIYGRDVQDSGDEAIPPDVREKLLRFARAGLAVATMRGRTYLSIG
GVSMGIAGSIVDHAFFRSWLDMRVQAVDMTELRRRLDRKIYDTAELETAQAWADARFRFG
IERNARPRDAAGKREILSESLAMTLCIRDMMHGNARLAAMGWAEEALGYDAIAAGFQGQR
HWTDQYPNADVAEALLNSSFDWSGARAPSILATENDCLNGATMLFGLLMSGKAQIFADVR
TFWSPEAVQRVTGHRLEGKSAGGILHLINSGAAALDGSCAVRDAQGAPTIKPHWQVDEDD
ISALLAATDWCPGLEEYFRGGGFSSHFVTRGGVAFTMVRLNLVAGIGPVLQIAEGWSVDL
PPAVHAALEARTDPSWPTTWFVPRLTGHGAFRDVYSVMASWGANHAVLAHGHVGADFVAL
AAMLRIPVCMHNLDEAAIDRPSLWGAFGSDKEGQDYRACAALGPLYGRRG
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgaacagatcttttccgaaaatcggcatccgcccgatcatcgacgggcggcgcggcggc
attcgcgaatcgcttgaagacgtcacgatggcgatggcccaccgcacggccgcgttcctg
acctcggaattgcgtcatgccgggggcgaggccgtggagtgcgtgatcgccgacacctgc
atcgcgggatacgccgaagccgcggcgtgcgaagagaaattcgcgtccgcgcatgtcgga
ctgtcgatttcggtgactccgtgctggtgttacggggcggagaccatcgacatggtgccg
gaacgccagaaggcgatctggggcttcaacggcacggaacggccgggcgcggtctatctg
gcggcggcgctggcggcccataaccagaaggggctgcccgccttttccatctatggacgg
gatgtccaggattccggcgacgaggcgatcccgcccgacgtgcgggaaaaactgctgcgg
tttgcccgcgcggggcttgcggtcgccacgatgcgcgggcgcacctacctgtcgatcggc
ggcgtgtcgatgggaatagcggggtcgatcgtcgatcacgcctttttccggtcgtggctg
gacatgcgcgtgcaggccgtggacatgacggaattgcggcgccggctcgacaggaaaatc
tacgacacggcggaactggagaccgcccaggcctgggcggacgcgcggttccgtttcggc
atcgagcgcaacgcccgtccgcgtgacgcggccgggaaacgcgaaatcctgtcggaaagc
ctggcgatgaccctgtgcattcgcgacatgatgcacggcaacgcgcgtctggcggcaatg
gggtgggcggaagaggcgctgggctatgacgcgatcgcggcgggtttccaggggcagcgt
cactggaccgaccagtatccgaacgccgatgtcgcggaggcattgctgaacagctcgttc
gactggagcggcgcgcgcgcacccagtatcctggcgaccgagaatgattgcctgaacggg
gcgaccatgctgttcggcctgctgatgagcggcaaggcccagattttcgccgatgtgcgc
acgttctggtcgcccgaggcggtgcagcgggtgacgggacaccggctggaaggcaaaagc
gcgggtggaatcctgcatctgatcaactcgggcgcggccgcgctggacgggtcctgcgcc
gtgcgcgacgcgcagggtgcgcccacgatcaagccgcactggcaggtggacgaggacgat
atctccgccctgctggccgcgacggactggtgcccgggactggaggaatatttccggggc
ggcggcttttccagccatttcgtgacacggggtggcgtggccttcaccatggtgcggctg
aacctggtcgccggaatcggtccggtgctgcagatcgcggaaggctggagcgtggacctg
ccgcctgccgtgcatgcggccctggaagcccgcacggacccgagctggccgacgacctgg
ttcgtgccgcggctgacggggcatggcgcgttccgcgacgtctattccgtcatggcgtca
tggggggcgaaccatgccgtgctcgcgcacgggcacgtgggcgcggacttcgtggcgctc
gccgccatgctgaggattccggtgtgcatgcacaacctggacgaagcggcgatcgatcgc
cccagcctctggggggcgttcggttccgacaaggaaggacaggactatcgcgcctgcgcc
gccctcggcccgctatacgggcgcaggggctga

DBGET integrated database retrieval system