KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_2695Help
Entry
GDI_2695          CDS       T00631                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:gdi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    GDI_2695 (rbsK)
Enzymes [BR:gdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     GDI_2695 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2790136..2791014
Genome map
AA seq 292 aa AA seqDB search
MSRVAVLGYASMDYVIVLGGAITPGRTSLIRARPTDGWPRVGGAPAFVSRAMNRGGIAHP
AIISQVGDDALGSAYRTALQADGADVRCLDVVAGARTPVTAMIYDATGECACLYEPLRNP
DGTEPAHLSGRQIALLEQAECVCLSVAPAGMIRQALRHARPDAMLAWIAKNDADAFPCDL
AAEIAGRADIIFSSLAEADMVAKAGRDAPARPGQILIETRGRDGACIRSNGVSRHRMTNP
VTVIDPSGAGDTLAGGMLAALIRDNADPDTALGAGMEAARAMLSERQNDKRA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcgtcgccgtcctcggctatgccagcatggattatgtcatcgtgctgggtggc
gcgatcacgcctggccgtaccagcctgatccgcgcgcgtccgaccgacggatggccgcgt
gtcggcggggccccggccttcgtatcccgcgcgatgaaccggggtggcatcgcccacccc
gcgatcatcagccaggtcggtgacgacgcgctgggatcagcctatcgcaccgccctgcag
gccgacggcgcagacgtgcgctgtctcgatgtcgttgccggagcccggacgccggttacc
gcgatgatctatgacgcgaccggcgaatgtgcctgcctttacgagccgctgcgcaatccc
gacggcacggagccggcacacctgtccgggcgacagatcgcgctgctggaacaggcggag
tgcgtgtgcctgagcgttgcccctgccgggatgatccgccaggcgctgcgccatgccaga
ccggacgcgatgctggcctggatcgcgaagaacgatgccgatgcctttccctgcgacctg
gcggcggaaatcgcaggccgcgccgacatcattttcagcagcctggccgaagccgacatg
gtggcgaaggccggacgcgatgcccccgcccgaccgggacagatcctgatcgagacccgg
gggcgagacggtgcctgcatccgcagtaacggcgtgagcaggcaccggatgacgaatccc
gtgacggttatcgacccgtcaggggccggcgacacgctggcaggcggcatgctggccgcc
ctgatacgcgacaacgccgatccggatactgcgctgggcgccggcatggaggccgcgcga
gccatgctgtccgaacggcaaaacgacaagagagcctaa

DBGET integrated database retrieval system