KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_2815Help
Entry
GDI_2815          CDS       T00631                                 

Gene name
recD
Definition
exodeoxyribonuclease
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gdi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    GDI_2815 (recD)
Enzymes [BR:gdi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     GDI_2815 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(2896416..2898602)
Genome map
AA seq 728 aa AA seqDB search
MSGRAIDSSPTEALAGLVERVTFHNAENGFCVLRVKVRGQRDLVTVVGHAAMISAGEFVQ
MSGRWFNDHTHGLQFKAEFLKASPPTTVEGIERYLGSGMIRGIGPVYAKKLVKAFGEAVF
DLIEQEPHRLREVTGIGPKRAERIVGGWADQKVIREIMLFLHSNGVGTSRAVRIFKTYGQ
DAVQLISENPYRLAKDIRGIGFKTADQIARKMGIAPDAMIRVRAGISYALGEAMEEGHCG
LPVGELLTSTAELLEVAAPLIETALALELEAGDVVADSVGDTDCIFLAGLYRAERSIAER
LRACAVGRPPWPEIDAAKAMTWVEGKTGLALAPSQQEAVRLALRSKVLVITGGPGVGKTT
LVNAILKIVTAKGTDVQLCAPTGRAAKRLSESTGLEGKTIHRLLETDPANGSFKRDDTNP
LTCDLLVVDEASMVDVLLMRSLLRALPDSAALLIVGDVDQLPSVGPGQVLADIIGSDAVP
VVRLTEVFRQAAQSRIITNAHRINEGKMPDLSAEEGSDFYFVEAAEPEAGLRKLLAVVKD
RIPARFGLDTVRDVQVLCPMNRGGLGARSLNIELQQALNPPGEVKVERFGWTYGPGDKVM
QIANDYDRDVFNGDLGVIDMIDVEEGELTVLFDGREVVYGFGELDELVLAYATTIHKSQG
SEYPAVVIPLVTQHYAMLARNLLYTGVTRGRKLVVLVGQKKALAIAVRNQGGRRRWSKLR
EWLAGSVA
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgagcggacgtgccatcgactcttcgcccacggaagcgctggcgggactggtcgagcgg
gtgacgttccataatgccgagaacggcttctgcgttctgcgggtgaaggtgcggggacag
cgcgatctggtcaccgtcgtcggccatgccgccatgatctcggcaggcgagttcgtgcag
atgtcggggcgctggttcaacgaccacacccacggcctccagttcaaggccgagttttta
aaggccagcccgccgaccacggtcgagggcatcgagcgctatctgggctcaggcatgatc
cggggcatcggtccggtctacgccaagaaactggtgaaagcgttcggcgaggcggtgttc
gacctgatcgaacaggaaccgcaccgcctgcgggaggtgacgggtatcggccccaagcgt
gccgaacggattgtcggtggctgggcggaccagaaggtgatccgcgagatcatgctgttc
ctgcacagcaatggtgtcggcacctcgcgggcggtgcggatcttcaagacctacggacag
gacgcggtccaactgatcagtgagaacccctaccggctggcgaaggacattcggggtatc
gggttcaagaccgctgaccagatcgcccggaagatggggatcgcgcccgacgccatgatc
cgggtacgggccgggatttcctatgcccttggcgaggcgatggaagaggggcattgcggt
ctgccggtcggggagctgctgaccagcaccgccgaactgctggaggtcgcggcacccctg
atcgagacggcgctcgcgctggaactggaagcaggggacgtggtcgccgacagcgtgggc
gatacggactgcattttcctggctggtctctatcgcgcggagcggagcattgcggagcga
ttgcgtgcctgtgccgtgggtcgaccgccctggcccgagatcgacgctgcaaaagccatg
acctgggtcgaaggcaagactgggcttgcgctcgcgcccagccagcaggaggcggtgcgc
cttgccctgcgcagcaaggtgctggtgatcacgggggggcccggtgtcggcaagaccacg
ctggtcaacgccatcctcaagatcgtgaccgccaagggcacggacgtgcagctttgtgcg
ccgacgggccgcgcggcgaagcgcctgtcggaaagcaccggactggaaggcaagaccatc
catcgactgctggagacggatccggcgaatggcagtttcaaacgggacgacaccaacccg
ctgacctgcgatctgctggtcgtggacgaggccagcatggtggacgtgctgctgatgcgc
tccctgctgcgcgcgttgcccgacagtgcggcgctgctgatcgtgggggacgtggaccag
ttgccgtcggtcggaccggggcaggtgctggcggatatcatcggttcagatgccgtgccg
gtggtgcggctgaccgaggtgttccgccaggcggcgcagagccggattatcaccaatgcg
caccggatcaacgaagggaagatgccggatctgagcgcggaagagggatcggatttctat
ttcgtggaggcggccgagcccgaggctgggctgcgcaagttgctggccgtggtgaaggac
cgcatcccggcgcggttcgggctggacacggttcgcgacgtgcaggtgctgtgcccgatg
aaccggggcggccttggggcgcgatcgctgaatatcgaattgcagcaggcgttgaatccg
ccgggcgaggtgaaggtcgagcggttcggctggacctatggtcccggcgataaggtgatg
cagatcgccaatgattatgaccgggacgtcttcaacggggatctcggcgttatcgacatg
atcgatgtggaagagggcgaactgacggtcttattcgatggacgggaagtcgtttatggc
tttggggaactggatgaactggtgctcgcctatgccaccacgatccacaagagccaggga
tccgaatatccggccgtggtgatcccgctggtgacccaacattacgccatgctggcgcgg
aacctgctctataccggcgtcacacggggacggaagctcgtcgtgctcgtgggccagaag
aaggcgctggcaatcgctgtgcgcaatcagggcgggcggcggcggtggtcgaagctcagg
gagtggctggccggtagcgttgcatga

DBGET integrated database retrieval system