KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_2951Help
Entry
GDI_2951          CDS       T00631                                 

Gene name
sucC
Definition
succinyl-CoA synthetase beta chain
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:gdi01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:gdi00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:gdi00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:gdi00660]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3039486..3040700
Genome map
AA seq 404 aa AA seqDB search
MNIHEYQAKALLKGFGMPVPDGRVVRSPDEALLAARAMGAPLVVVKAQIHAGGRGAGHFA
HDPGGKGGVRLARTPEDAEQAAIAMLDQTLVTRQTGSAGRVVRRLYIEAGCDIGRELYLS
LLVDRGTGRIVIVASQDGGMAIEDVAAATPERILKEPIDPATGLSDYQARTLAARLDLHG
RSIRAFTTVLRAAYDAFVALDAAIVEINPLVVTRSGDLLALDAKMSFDDNALFRHPELEE
LRDENEEDPREREAARHGLAYVGLDGTIGCMVNGAGLAMATMDIIKMEGEEPANFLDVGG
GATRERVAAAFRILLSDRKVRGILVNIFGGIMRCDIIADAIVAASRETGLHVPLVVRLAG
TNVEQGHQILSASGLRIIPADDLADAATKIVAAVRETAFAGGAA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaacatacatgaatatcaggcaaaggccctgttgaagggcttcggcatgccggttccc
gatgggcgcgtcgtccgttccccggacgaagccctgctggccgcccgcgcgatgggcgcc
ccgctggtggtggtcaaggcgcagatccatgccggcggccgcggcgcgggtcatttcgcc
catgatcccggcggcaagggcggcgtacgcctggcccgcacgcccgaggatgccgagcag
gccgccatcgcgatgctggaccagaccctggtcacgcgccagaccggctctgccggccgc
gtggtccgccgcctgtatatcgaggccggatgcgatatcgggcgcgagctgtacctgtcg
ctgctggtggatcgcggcactgggcgcatcgtcatcgtggcgtcgcaggacggcggcatg
gcgatcgaggacgtcgccgccgccacgcccgagcgtatcctgaaggaaccgatcgacccg
gccaccggcctgtccgactaccaggcgcgcacgctggcggcgcggctggacctgcatgga
cggtcgatccgcgccttcaccaccgtgctgcgcgcggcctatgacgcgttcgtggcgctg
gacgccgcgatcgtcgagatcaatccgctggtcgtcacccggtcgggcgaccttctggcg
ctggacgccaagatgagcttcgacgacaacgcgctgttccgccatccggaactggaagaa
ctgcgcgacgagaacgaggaagacccccgcgagcgcgaggccgcgcgccacggcctggcc
tatgtcgggctggacgggaccatcggctgcatggtcaacggcgccgggctggcgatggcg
accatggacatcatcaagatggagggcgaggaaccggccaacttcctggacgtgggcggc
ggcgccacgcgcgaacgggtggcggcggcgttccgcatcctgctgtccgaccgcaaggtg
cgcggcatcctggtgaacatcttcggcggcatcatgcgctgcgacatcatcgcggacgcc
atcgtcgccgcgtcgcgcgaaacggggctgcacgtgccgctggtggtgcggctggccggc
accaacgtcgaacaggggcaccagatcctgtcggcatcggggctgaggatcatcccggcc
gacgacctggccgacgcggccaccaagatcgtcgccgccgtgcgcgaaaccgctttcgcc
gggggggccgcctga

DBGET integrated database retrieval system