KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_3014Help
Entry
GDI_3014          CDS       T00631                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gdi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GDI_3014 (hemB)
Enzymes [BR:gdi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     GDI_3014 (hemB)
Exosome [BR:gdi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GDI_3014 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3101448..3102443
Genome map
AA seq 331 aa AA seqDB search
MTLGRFPATRPRRNRQDDFTRRLVAETTLTVDNLIWPIFVMEGTDTQTEVASMPGVRRVT
LDRLAAHVEPAAALGIPALALFPITPTSLRDAEGTEAMNPDNLMCRAARVLKREFPDMGL
IGDVALDPYTDHGHDGLIRDGYVVNDESVAVLSRQAVNQAAAGIDIIAPSDMMDGRIGVI
RRDLDAQGLTGTRIMSYAAKYASAFYGPFRDALGSGGLLKGDKKTYQMDPANSDEALREV
EQDLAEGADMVMVKPGMPYLDIIRRVHDRFAVPTFAYQVSGEYAMLTAAMDHGWLDRDRT
MLESLMAFRRAGASGVLTYFAVDAARRLRGG
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcggccgctttcccgccacccgtccgcgccgcaaccgccaggacgatttcacc
cgacgcctggtcgcggaaacgacgctgacggtcgacaacctgatctggccgatcttcgtc
atggaaggcaccgacacgcagaccgaggtcgcctcgatgcccggcgtgcgccgggtgacg
ctggaccggctggcggcccatgtcgaaccggcggcggcgctgggcattccggccctggcg
ctgttcccgatcacccccacctccctgcgcgacgcggaggggaccgaggcgatgaacccc
gacaacctgatgtgccgggcggcgcgcgtgctgaagcgtgaattccccgacatgggcctg
atcggggacgtggcgctggacccctataccgaccatgggcatgacggactgatccgcgac
ggatatgtcgtcaacgacgaatccgtcgccgtcctgtcgcggcaggcggtcaaccaggcg
gcggccggcatcgacatcatcgcgccgtccgacatgatggacggccgcatcggcgtcatc
cgccgcgacctggacgcgcagggcctgaccggcacgcggatcatgtcctatgccgccaaa
tatgccagcgcgttctatggcccgttccgcgacgcgctgggatcgggcgggctgctgaag
ggcgacaagaagacctaccagatggacccggccaacagcgacgaggccctgcgcgaggtg
gagcaggacctggccgagggggcggacatggtcatggtcaagcccgggatgccgtatctg
gacatcatccgccgggtccatgaccgcttcgcggtgccgaccttcgcgtaccaggtatcg
ggcgaatacgcgatgctgaccgcagccatggaccatggctggctggaccgcgaccgcacc
atgctggaaagcctgatggccttccgccgcgccggcgccagcggggtgctgacctatttc
gcggtggacgccgcacgccggctgcggggcggctga

DBGET integrated database retrieval system