KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_3112Help
Entry
GDI_3112          CDS       T00631                                 

Definition
alpha/beta hydrolase
Orthology
K01259  
proline iminopeptidase [EC:3.4.11.5]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Pathway
Arginine and proline metabolism
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:gdi00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3205325..3206290
Genome map
AA seq 321 aa AA seqDB search
MTYSRPMPRHDLFPDIAPYDSGYLPVGDGHELYWEQAGNPAGRTVLFLHGGPGAGAGAVH
RRFFDPEHWRVVLFDQRGAGRSRPHASIAANTTPHLVRDIETLRQALGIGDWLLFGGSWG
STLALAYAQAHPERVRAMILRGIFLGRPRELDWFFHGLAHVFPDAHAAFLSHLPEAERDD
PLGAYGRLLFDPDPAIHLPAARAWSAYEGTCSTLIPAPAAVAGFAQDRAVIGLARIEAHY
FRHGLFLPPEGLLGAMERIAHIPCTIVQGRYDMICPSESAWDLSRHWPRATLVMVPDAGH
SALEPGIRRRLVACVEEMRDA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
ttgacgtatagtcgccccatgccacgccacgacctgttcccggacatcgcgccctacgac
agcggctacctgcctgtcggcgacgggcacgaactctattgggaacaggcgggcaacccc
gcagggcggacggtgctgttcctgcatggcggtccgggcgcgggcgcgggcgcggtccat
cgccgcttcttcgacccggaacattggcgcgtcgtcctgttcgaccagcggggggccggg
cggtcgcggccgcatgcgtcgatcgcggccaacacgacaccgcacctggtgcgcgatatc
gaaacgctgcgccaggcgctgggcatcggggactggctgctgttcggcgggtcgtgggga
tcgacgctggcgctggcctacgcccaggcgcaccccgaacgggtgcgcgcgatgatcctg
cgcgggatcttcctgggccggccgcgcgaactggactggttcttccacggcctggcccat
gtcttccccgacgcgcacgcggccttcctgtcgcacctgcccgaagcggaacgggatgat
ccgctgggcgcctatggccggctgctgttcgatcccgaccccgcgatccacctgccggcg
gcgcgggcctggtcggcctacgagggaacgtgctcgacgctgattcccgcccccgccgcc
gtcgccggcttcgcgcaggaccgcgccgtcatcggcctggcgcggatcgaggcccattat
ttccggcacggcctgttcctgccgcccgagggcctgctgggcgcgatggagcggatcgcg
catattccctgcaccatcgtccagggccggtatgacatgatctgccccagcgagtccgcc
tgggacctgtcccggcactggccgcgcgccaccctggtcatggtgccggatgccgggcac
tcggccctggaaccgggcatccgccgccggctggtcgcgtgcgtcgaggagatgcgcgac
gcatga

DBGET integrated database retrieval system