KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_3163Help
Entry
GDI_3163          CDS       T00631                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:gdi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    GDI_3163 (rbsK)
Enzymes [BR:gdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     GDI_3163 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3249582..3250532
Genome map
AA seq 316 aa AA seqDB search
MPRPKSKNHPLVVFGSINIDMVARLHHFPAPGETLHAQGTDLGLGGKGANQAVAVARLGA
EVLLMGRTGDDMFADYAATSLRRRGVGPDGLFRSPGDTTGLAMICTDSAGENTIVVAGGA
NLAMDGDDVARLVPLLTPGAIVLMQCEIPMDTILAAARRVDAAGATLILDPAPVPDAGLP
DELFRLATLMTPNETETERLTGLRPHDPDSARQAAGRLHQKGLRRAIIKLGARGVLYSDE
SGHGFIPPFHVTAIDSVAAGDCFNGGLAVALSQGLDLARATRFAAACGALATTRKGAADA
APTREEVEGLLSAQPR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgccccgacccaaaagtaaaaatcaccctctggttgtattcggtagcatcaatatcgat
atggtcgcccggttgcatcactttcccgcgccaggcgaaactttacacgcacagggcacc
gacctggggcttgggggcaagggcgccaaccaggcggtggcggtcgcgcgcctgggggcg
gaggtcctgctgatgggccggaccggcgacgacatgttcgccgactacgccgctacctcc
ctgcggcggcgcggcgtcgggccggacggcctgttccgctcgcccggcgacacgaccggc
ctggccatgatctgcaccgacagcgcgggggaaaacaccatcgtcgtcgccgggggcgcc
aacctggcgatggatggcgacgatgtggcacgcctggtgccgctgctgacgccgggcgcg
atcgtgctgatgcagtgcgagatcccgatggacaccatcctggccgccgcccgccgggtc
gacgccgccggcgcgaccctgatcctggaccccgccccggtccccgatgccggcctgccc
gacgaattgttccgtctggccacgctgatgacccccaacgaaaccgagaccgaacgcctg
accggactgcgcccccacgaccccgacagcgcgcgccaggccgcgggccggctgcaccaa
aaggggctgcgccgggccatcatcaagctgggcgcgcggggcgtgctgtattccgacgag
tcgggccacggattcattccccctttccacgtcaccgccatcgacagcgtggcggcgggc
gattgtttcaatggcgggctggccgtagcgttgtcgcagggcctggacctggcccgggcc
acgcgcttcgccgccgcctgcggcgcgctggccaccacgcgcaagggcgcggcggacgcc
gccccgacccgcgaggaagtggagggcctgctttcggcacagccgcgataa

  All links  
No link information was found.   
DBGET integrated database retrieval system