KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_3174Help
Entry
GDI_3174          CDS       T00631                                 

Gene name
proB
Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gdi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GDI_3174 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    GDI_3174 (proB)
Enzymes [BR:gdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     GDI_3174 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3261052..3262200
Genome map
AA seq 382 aa AA seqDB search
MTAPESTGLPDLGAARRVVVKIGSALVVDSGTEPGQAAPRAAWLDSVARDIAELRRAGTD
IIVVSSGAIALARHGLGLTRRTLRLEEKQAAASVGQIRLAQAWTDALSVHGLVAAQLLLT
PDDTEDRRRYLNARATLDTLLGLGCVPVINENDAIATTEIRFGDNDRLAARVAEMTGADQ
LILLSDIDGLYTADPRIDPTARHLPVIPALTAEIEAMGGAPPPGYSSGGMRTKLMAARIA
TQAGCAMAITIGKDVHPLARLRQGARCSWFLPMPDGRSARKRWIAGGLAPAGRLAIDDGA
RRALATGSSLLPAGVRTVEGDFERGDLLLVTDLDGNEIARGLSAYSAADARQIAGHRSDD
IEGLLGWRGRDEMIHRDDLVLG
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcccccgaatccaccggcctgcccgacctgggcgccgcccgccgcgtcgtcgtg
aagatcggcagcgcgctggtcgtggattcggggaccgagcccggccaggccgcgccgcgc
gccgcctggctggacagcgtcgcccgcgacattgcggagcttcggcgcgccggcaccgac
atcatcgtcgtgtcctcgggcgccatcgcgctggcgcggcacgggctgggactgacgcgc
cgcaccctgcggctggaggaaaagcaggccgcggcctcggtcgggcagatccgcctggcc
caggcctggaccgacgcgctgtcggtgcacggactggtcgccgcgcaattgctgctgacc
cccgacgacaccgaggaccggcgccgctacctgaacgcccgcgccacgctggacaccctg
ctgggcctgggctgcgtgcccgtgatcaacgagaacgacgcgatcgccaccaccgaaatc
cgcttcggcgacaatgaccgcctggccgcccgggtggcggaaatgaccggcgccgaccag
ttgatcctgctgtcggacatcgacgggctctataccgccgacccgcgcatcgaccccacg
gcgcggcacctgccggtcatccccgccctgacggcggagatcgaggccatgggtggcgcc
ccgccaccgggctattcctcgggcgggatgcgcaccaagctgatggcggcgcgcatcgcc
acccaggccggctgcgcgatggccatcacgatcggcaaggacgtccacccgctggcccgg
ctgcgccagggggcgcgctgctcgtggttcctgccgatgccggacgggcgttcggcgcgc
aagcgctggatcgcgggcggcctggcccccgcggggcggctggccatcgatgacggcgcc
cgccgcgcgctggccaccgggtcgtcgctgctgcccgccggggtacgcacggtggagggc
gacttcgaacgcggcgacctgctgctggtcaccgacctggacgggaacgagatcgcgcgc
ggcctgtcggcctacagcgccgccgacgcccgccagatcgccggccaccgctcggacgat
atcgaaggacttctgggctggcgcggccgggacgagatgattcaccgcgacgacctggta
ctgggctga

DBGET integrated database retrieval system