KEGG   Gluconacetobacter diazotrophicus PAl 5 (Brazil): GDI_3186Help
Entry
GDI_3186          CDS       T00631                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
gdi  Gluconacetobacter diazotrophicus PAl 5 (Brazil)
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:gdi00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    GDI_3186 (murE)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    GDI_3186 (murE)
Enzymes [BR:gdi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     GDI_3186 (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3272403..3273866
Genome map
AA seq 487 aa AA seqDB search
MTHPLSQVLAAAGLSAPPGADPAITGVTADSRRVTPGMLFVAIPGTRADGSAFIPAAIAA
GAAAIVAPRGTPAPGVPVIGVDEPRRALALLAAFLAGAQPDHVVAVTGTNGKTSTVDFLR
QIWGHQHRRAASIGTLGVIADIDLPDCGPVLTTPDSVGLATLLAAMARGGVTDVAIEASS
HGLDQHRLDGLRLSAAGFTNLTRDHLDYHGTLDAYRAAKLRLFDTLLPPDGLMAANADMD
TATLDALRDIAARRGLDLRLVGEAGDAIRLLGSTPLPEGQHLRIASGGVARDIVLALPGR
FQADNALLAAALAAPGADGLARAIDLLPALRGVRGRMERAALLPNGAAAYVDYAHTPDAL
ARLLDALRPHASGRLIAVFGAGGDRDRGKRPLMGQEATRRADIAIVTDDNPRTEDPAFIR
GEVLAGAPGAIEIGDRARAIAEGLSMLRAGDVLVVAGKGHEQGQTIGTATLPFDDASVIR
DLAGVRA
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgacccaccccctgtcccaggtgctggcggcggccggcctgtccgccccgcccggcgcc
gacccggcgattaccggcgtgaccgccgacagccggcgggtgacgccgggcatgctgttc
gtcgccattcccggcacgcgcgccgacggcagcgccttcatccccgccgcgatcgccgcc
ggcgccgccgcgatcgtcgcaccgcgcgggacccccgcgcccggcgtcccggtcatcggg
gtggacgaaccgcgccgggcgctggccctgctggcggcgttcctcgccggggcgcagccg
gaccatgtcgtcgccgtcaccggcaccaacggcaagaccagcaccgtcgatttcctgcgc
cagatatggggccatcagcaccgccgcgccgccagcatcggcacgctgggggtgatcgcg
gacatcgaccttcccgattgcgggccggtcctgaccacgccggacagcgtgggcctggcc
accctgctggccgccatggcgcgcggcggcgtcaccgacgtggccatcgaggcatcgtcc
cacgggctggaccagcaccggctggacgggctgcgcctgtcggcggccggctttaccaac
ctgacccgagaccatctggactatcacggcacgctggacgcctaccgcgcggccaagctg
cgcctgttcgacacgctgctgccgccggacgggctgatggcggcgaatgcggacatggac
accgcgacgctggacgcgctacgcgatattgccgcgcggcggggactggacctgcgcctg
gtcggcgaagcgggagatgcgatccgcctgctgggcagcaccccgctgcccgagggccag
catctgcggatcgcgtcgggcggggttgcgcgcgacatcgtcctggcactgcccggccgc
ttccaggccgacaatgcgctgctggcggcggcgctggccgcgccgggcgccgacgggctg
gcccgggcgatcgacctgctgcctgcgctgcgcggcgtgcgcggacggatggagcgcgcg
gcgctgctgcccaacggggcggcggcctatgtcgattacgcccataccccggacgcgctg
gcccgcctgctggacgcgctgcgcccgcacgcctcgggccggctgatcgccgtgttcggc
gccggcggcgaccgcgatcgcggcaagcgcccgctgatggggcaggaagcgacccgccgc
gccgacatcgccatcgtcaccgacgacaacccccgcaccgaggaccccgccttcatccgg
ggcgaggtcctggccggcgcgccgggcgcgatcgaaatcggcgatcgcgcgcgggcgatc
gccgagggcctgtcgatgctgcgggccggcgacgtgctggtggtggccggcaagggccac
gaacagggccagaccatcggcaccgcgacgctgcccttcgatgacgcatcggtcattcgc
gacctggccggggtgcgggcatga

DBGET integrated database retrieval system